Potri.014G141600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G204000 54 / 7e-09 ND /
Potri.002G058200 51 / 1e-07 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039737 50 / 2e-07 ND /
Lus10041112 47 / 2e-06 ND /
Lus10018519 45 / 6e-06 ND /
Lus10036438 44 / 1e-05 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.014G141600.1 pacid=42762822 polypeptide=Potri.014G141600.1.p locus=Potri.014G141600 ID=Potri.014G141600.1.v4.1 annot-version=v4.1
ATGATTTCCCAGAGCAAGCCAATCGAAATTATGAGAAAGAGACCCACTATTCAATCATCGCCATCCAAGGAGGAGAAGCAACGGTTCAGCAACTCGATCA
GAGCTCTACGTCCCAGGGTTTATATCACCGATACGTCGAAATTCAAGACACTCGTTCAAGAACTAACTGGTAATGGAAAAGGCAGCAGCAGCTGCATCTC
TTCCCCGCCTGAAGGTAGTTCACCACAAGCCATCCAAAAAGCCCCGTTCATCGGCATTGAAGATCAAGAATACGATCACCGTGAAAGTAGCTTGGAGACA
ATATCGGTTGAAGGATATGTTCATAACTCGTTTGATTTATGCAAAGTATTCCAGACTGATCATCACCAAGTTCATGGTTACAATCAGCAGGCATATATGG
CTGATGTTTCAGCATTTGGTGATCACATGTCATTGCCAATGGACCAGCAAGAGGACTCACTAGCCTATCATGATCTCGAGTCGTGGCTTTTGAGTAGTGA
GGAGCCGTGTTCTTCTTCCTATAATGGTTATTATGCTCAAACTCAGCAGCAAGTCAACATATACGATTATACTAGCTATCTGGGATAA
AA sequence
>Potri.014G141600.1 pacid=42762822 polypeptide=Potri.014G141600.1.p locus=Potri.014G141600 ID=Potri.014G141600.1.v4.1 annot-version=v4.1
MISQSKPIEIMRKRPTIQSSPSKEEKQRFSNSIRALRPRVYITDTSKFKTLVQELTGNGKGSSSCISSPPEGSSPQAIQKAPFIGIEDQEYDHRESSLET
ISVEGYVHNSFDLCKVFQTDHHQVHGYNQQAYMADVSAFGDHMSLPMDQQEDSLAYHDLESWLLSSEEPCSSSYNGYYAQTQQQVNIYDYTSYLG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.014G141600 0 1
Potri.014G065900 1.73 0.8945
AT5G44440 FAD-binding Berberine family p... Potri.001G464700 3.31 0.9089
Potri.019G017300 5.09 0.8965
AT4G08780 Peroxidase superfamily protein... Potri.003G214900 6.92 0.8916
AT5G19875 unknown protein Potri.001G009200 9.21 0.8866
AT3G04945 LCR18 low-molecular-weight cysteine-... Potri.013G032700 11.22 0.8763
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134200 12.40 0.8699
Potri.002G075850 16.91 0.8558
Potri.015G098650 17.43 0.8797
AT4G01410 Late embryogenesis abundant (L... Potri.014G106100 17.60 0.8731

Potri.014G141600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.