Pt-ARPC1.1 (Potri.014G141700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-ARPC1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30910 621 / 0 ARPC1B, ARPC1, ARPC1A actin-related protein C1A (.1.2.3)
AT2G31300 613 / 0 ARPC1b actin-related protein C1B (.1)
AT4G11920 45 / 4e-05 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1)
AT4G22910 45 / 5e-05 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
AT5G67320 45 / 9e-05 HOS15 high expression of osmotically responsive genes 15, WD-40 repeat family protein (.1)
AT2G30050 44 / 0.0001 transducin family protein / WD-40 repeat family protein (.1)
AT4G02730 44 / 0.0001 AtWDR5b human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
AT2G26060 43 / 0.0002 EMB1345 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G13840 43 / 0.0002 FZR3 FIZZY-related 3 (.1.2)
AT2G01330 42 / 0.0007 nucleotide binding (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G041200 49 / 3e-06 AT3G18060 1000 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Potri.010G202100 49 / 4e-06 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2)
Potri.002G051900 48 / 5e-06 AT4G02730 524 / 0.0 human WDR5 \(WD40 repeat\) homolog b, Transducin/WD40 repeat-like superfamily protein (.1)
Potri.008G057500 48 / 8e-06 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2)
Potri.006G045800 47 / 1e-05 AT2G41500 614 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Potri.009G115300 46 / 2e-05 AT4G34460 624 / 0.0 ERECTA-LIKE 4, GTP binding protein beta 1 (.1.2.3.4)
Potri.012G049200 45 / 6e-05 AT3G18060 1018 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Potri.001G112700 45 / 8e-05 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.003G119500 45 / 8e-05 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031375 609 / 0 AT2G30910 579 / 0.0 actin-related protein C1A (.1.2.3)
Lus10038960 53 / 2e-07 AT3G18060 971 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Lus10027252 53 / 3e-07 AT3G18060 979 / 0.0 transducin family protein / WD-40 repeat family protein (.1)
Lus10021059 49 / 3e-06 AT2G41500 706 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10004167 46 / 3e-05 AT2G41500 708 / 0.0 LACHESIS, WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related (.1)
Lus10024482 45 / 9e-05 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Lus10026337 44 / 0.0002 AT4G34460 570 / 0.0 ERECTA-LIKE 4, GTP binding protein beta 1 (.1.2.3.4)
Lus10001192 44 / 0.0002 AT4G22910 734 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Lus10042325 44 / 0.0002 AT4G34460 598 / 0.0 ERECTA-LIKE 4, GTP binding protein beta 1 (.1.2.3.4)
Lus10021365 43 / 0.0002 AT2G26060 482 / 2e-172 embryo defective 1345, Transducin/WD40 repeat-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
CL0186 Beta_propeller PF07676 PD40 WD40-like Beta Propeller Repeat
Representative CDS sequence
>Potri.014G141700.1 pacid=42764435 polypeptide=Potri.014G141700.1.p locus=Potri.014G141700 ID=Potri.014G141700.1.v4.1 annot-version=v4.1
ATGGCAGCCGTTGAAGTTCATCAGTTCGCTCAGTGCATCACTTGCCACGCTTGGAGCGCGGATCGATCTATGATTGCATTTTGTCCAAACAACAATGAAG
TTCACATATATAGATTGTCCCAAGACAAGTGGGAGAAGGTCCATGTTCTTCAAAAGCATGACCAGATTGTTTGTGGGATAGATTGGAGTGCGAGATCAAA
CAGAATTGTTACTGCATCTCATGATCGAAATTCATATGTCTGGAACCAAGAAGGATCAGAATGGGTACCGACCCTTGTTATACTCAGGCTAAACCGCGCT
GCACTTTGTGTGCAGTGGAGTCCAAAAGAGAACAAGTTCGCTGTTGGAAGTGGGGCTAAAACTGTTTGTATATGCTACTATGAGCAAGACAACAACTGGT
GGGTCAGTAAACTTATCAGGAAAAGACATGATTCCTCGGTGACAAGTGTTGCCTGGCATCCTAATAATATTCTTCTTGCGACAACATCTACAGATGGAAA
ATGTCGAGTGTTTTCCACTTTTATTAAAGGTGTTGATACAAGGGATTCCAAAGCAGGCTCTGTCTCAGATTCAAAATTTGGAGAGCAAATTGTTCAGCTT
GATCTCTCGTTTTCCTGGGCATTTGGTGTGAAGTGGTCGCCTAGTGGCAATACCTTGGCTTACGTAGGACATAATTCCATGATTTATTTTGTTGATGATG
TTGGTCCATCTCCATTGGCCCAGAATGTTGCATTTCGCGATTTACCTCTCCGTGATGTCTTATTTGTTTCTGAGAAAATGGTCATAGGAGTGGGATTCGA
CTGCAACCCTATGGTTTTTGCAGCAGATGAAAGAGGAATATGGAGCTTTATCAGGTTCCTTGGTGAAAGAAAATCAACACTTTCAGGTTCAAGATACAGT
TCACAGTTTTCTGAAGCATTTGGAAAATTTTATGGCCAATCGAAGTATGGAGCGAGCAATGATGGCATTGAACCTTCAAGGTCACGTGGAGGCATTCACG
AGAATTGCATAAGTTGTATTATGTCTCTTACAGAATCAGGGAGTTCTAGAAAAACACGCTTCAGCACTTCAGGATTGGATGGTAAAGTAGTTGTTTGGGA
TTTGGAGAACCAGGAAGATCTATCTGGATATCTGTAA
AA sequence
>Potri.014G141700.1 pacid=42764435 polypeptide=Potri.014G141700.1.p locus=Potri.014G141700 ID=Potri.014G141700.1.v4.1 annot-version=v4.1
MAAVEVHQFAQCITCHAWSADRSMIAFCPNNNEVHIYRLSQDKWEKVHVLQKHDQIVCGIDWSARSNRIVTASHDRNSYVWNQEGSEWVPTLVILRLNRA
ALCVQWSPKENKFAVGSGAKTVCICYYEQDNNWWVSKLIRKRHDSSVTSVAWHPNNILLATTSTDGKCRVFSTFIKGVDTRDSKAGSVSDSKFGEQIVQL
DLSFSWAFGVKWSPSGNTLAYVGHNSMIYFVDDVGPSPLAQNVAFRDLPLRDVLFVSEKMVIGVGFDCNPMVFAADERGIWSFIRFLGERKSTLSGSRYS
SQFSEAFGKFYGQSKYGASNDGIEPSRSRGGIHENCISCIMSLTESGSSRKTRFSTSGLDGKVVVWDLENQEDLSGYL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G30910 ARPC1B, ARPC1, ... actin-related protein C1A (.1.... Potri.014G141700 0 1 Pt-ARPC1.1
AT4G25600 Oxoglutarate/iron-dependent ox... Potri.012G142800 1.00 0.9434
AT5G26667 PYR6 P-loop containing nucleoside t... Potri.002G134600 1.41 0.9428
AT1G09330 ECHIDNA, ECH unknown protein Potri.013G006250 2.00 0.9306
AT1G79820 SGB1 SUPPRESSOR OF G PROTEIN BETA1,... Potri.001G185300 2.23 0.9296
AT2G28310 Protein of unknown function (D... Potri.009G011000 3.00 0.9344
AT4G34660 SH3 domain-containing protein ... Potri.004G161300 3.16 0.9156
AT5G21070 unknown protein Potri.009G158800 4.24 0.9274
AT2G44610 RAB6, AtRABH1b,... Ras-related small GTP-binding ... Potri.002G135500 6.32 0.8833 Pt-RAB6.1
AT3G57090 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide ... Potri.009G047300 6.92 0.9209
AT4G00750 S-adenosyl-L-methionine-depend... Potri.014G075700 9.00 0.9193

Potri.014G141700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.