Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-S6PDH.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21260 101 / 5e-28 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 100 / 9e-28 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 52 / 1e-09 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37770 49 / 1e-08 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT3G53880 47 / 7e-08 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 45 / 3e-07 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT1G59960 44 / 7e-07 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 42 / 4e-06 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 37 / 0.0003 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G125100 [exp] 119 / 8e-35 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 51 / 2e-09 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G144600 [exp] 51 / 4e-09 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 50 / 4e-09 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 50 / 5e-09 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 50 / 6e-09 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.012G040050 [exp] 49 / 7e-09 AT1G59960 135 / 9e-40 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.010G036801 [exp] 45 / 3e-07 AT1G59960 187 / 2e-59 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.017G070600 [exp] 44 / 7e-07 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042054 [exp] 112 / 2e-31 AT2G21250 548 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10018058 [exp] 110 / 3e-31 AT2G21250 543 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010885 [exp] 59 / 4e-12 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 54 / 3e-10 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024354 [exp] 50 / 7e-09 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 50 / 1e-08 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 49 / 2e-08 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10031739 [exp] 47 / 1e-07 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 45 / 3e-07 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 45 / 4e-07 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G144700.2 pacid=42763521 polypeptide=Potri.014G144700.2.p locus=Potri.014G144700 ID=Potri.014G144700.2.v4.1 annot-version=v4.1 ATGGCAATAACACTGAACAATGGATTCAAGATGCTAATAATTGGCTTAGGTGTATGGCGGATGGAAGGGAAAGAAATCAGAAACCTCATTATTAATCCTA TTAAGCTTGGCTACCGTCATTTTGATTGTGCAGCTGATCACAAGAGTGAAGCAATAATAGGGGAGGTGTTAGCCGAAGTATTCAAAACAGGGCTTGCTTA G
AA sequence Show only first row Show all	>Potri.014G144700.2 pacid=42763521 polypeptide=Potri.014G144700.2.p locus=Potri.014G144700 ID=Potri.014G144700.2.v4.1 annot-version=v4.1 MAITLNNGFKMLIIGLGVWRMEGKEIRNLIINPIKLGYRHFDCAADHKSEAIIGEVLAEVFKTGLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G21260			NAD(P)-linked oxidoreductase s...		Potri.014G144700 [exp]	0	1	Pt-S6PDH.1
AT3G22960		PKP-ALPHA, PKP1	PLASTIDIAL PYRUVATE KINASE 1, ...		Potri.005G216750 [exp]	1.41	0.7228
					Potri.002G038350 [exp]	28.87	0.5834
AT5G62570			Calmodulin binding protein-lik...		Potri.015G071800 [exp]	42.63	0.5511
AT4G39870			TLD-domain containing nucleola...		Potri.007G092700 [exp]	88.81	0.4909
					Potri.019G016108 [exp]	98.90	0.4637
AT5G27360		SFP2	Major facilitator superfamily ...		Potri.013G027800 [exp]	129.00	0.4525
AT5G66550			Maf-like protein (.1)		Potri.007G025000 [exp]	140.86	0.4561

Compare expression of checked genes

Potri.014G144700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.