Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02010 108 / 8e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G56690 92 / 4e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09410 90 / 2e-21 pentatricopeptide (PPR) repeat-containing protein (.1) AT2G27610 86 / 7e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G68930 85 / 1e-19 pentatricopeptide (PPR) repeat-containing protein (.1) AT5G39680 82 / 2e-18 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 81 / 2e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT4G37170 81 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G12770 80 / 6e-18 MEF22 mitochondrial editing factor 22 (.1) AT5G46460 79 / 2e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G237100 [exp] 127 / 1e-34 AT3G02010 967 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G091600 [exp] 89 / 4e-21 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G006400 [exp] 84 / 3e-19 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G005400 [exp] 82 / 8e-19 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G354400 [exp] 82 / 9e-19 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G184800 [exp] 82 / 1e-18 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G048800 [exp] 81 / 4e-18 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G086900 [exp] 79 / 1e-17 AT4G14850 964 / 0.0 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G058300 [exp] 79 / 2e-17 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031994 [exp] 110 / 2e-28 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035164 [exp] 110 / 2e-28 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10015256 [exp] 89 / 6e-21 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10036921 [exp] 83 / 7e-19 AT4G37170 806 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004892 [exp] 82 / 1e-18 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013149 [exp] 81 / 4e-18 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027561 [exp] 75 / 4e-18 AT3G49142 155 / 1e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025375 [exp] 77 / 5e-18 AT2G02980 141 / 2e-39 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019864 [exp] 78 / 3e-17 AT2G15690 477 / 3e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008570 [exp] 78 / 3e-17 AT2G15690 375 / 9e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0109 [poplar] [flax] CDA PF14432 [poplar] [flax] DYW_deaminase DYW family of nucleic acid deaminases
Representative CDS sequence Show only first row Show all	>Potri.014G145550.1 pacid=42764697 polypeptide=Potri.014G145550.1.p locus=Potri.014G145550 ID=Potri.014G145550.1.v4.1 annot-version=v4.1 ATGACCTCTTGCATGCAATCCAAGCCTGATACCAGTTGTGCCCATTGTGCCCATCAGAATGTGGATGATGAAAGAAAAATTGACTCTCTGAAATATCACC GTGAACGCTCAGCAATAGCGTTTGCACTGATCAGTACCCCGGAGGGAGCGCCGATCCTGGTGGCGAGGAACTTGCGAGCTTGTACAGACAGCCATGCTGC AATCAACGAGATCTCAAAAACTGTAGGGAGGGAAATTACAGTAAGGGATTCAAACAGGTTTATCATTTTAGAGATGGGTTTTGCTCTTGCAGGGATTATT GGAATATTGACTGGGAATTGGGGAGTTTCATTTCCCTTTCTCAATGACCGCTCAAGCAATGGTACTTCTCAAGAAAGAGCGGATTCTTTTGGAGGGGAAA CCCCCTCCTTGAATGCAGCCATGGAAAATTTTTCATCTCTATCAGGTTCCTATTCTCCATTCCTTGCAGCTTATCATGAACCAGAATAA
AA sequence Show only first row Show all	>Potri.014G145550.1 pacid=42764697 polypeptide=Potri.014G145550.1.p locus=Potri.014G145550 ID=Potri.014G145550.1.v4.1 annot-version=v4.1 MTSCMQSKPDTSCAHCAHQNVDDERKIDSLKYHRERSAIAFALISTPEGAPILVARNLRACTDSHAAINEISKTVGREITVRDSNRFIILEMGFALAGII GILTGNWGVSFPFLNDRSSNGTSQERADSFGGETPSLNAAMENFSSLSGSYSPFLAAYHEPE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G02010			Pentatricopeptide repeat (PPR)...		Potri.014G145550 [exp]	0	1
AT5G09590		HSC70-5, mtHSC7...	HEAT SHOCK COGNATE, mitochondr...		Potri.001G285500 [exp]	47.66	0.7888
AT1G79920		AtHsp70-15	heat shock protein 70-15, Heat...		Potri.003G055800 [exp]	101.27	0.7660	Pt-HSP91.3
					Potri.010G110751 [exp]	120.56	0.7590
AT1G77470		EMB2810, RFC5, ...	replication factor C 5, EMBRYO...		Potri.005G180001 [exp]	129.07	0.7045
AT4G02450			HSP20-like chaperones superfam...		Potri.005G199700 [exp]	142.37	0.7456
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Potri.008G168800 [exp]	211.20	0.6912
AT4G27220			NB-ARC domain-containing disea...		Potri.011G124100 [exp]	249.43	0.7003
AT4G33990		EMB2758	embryo defective 2758, Tetratr...		Potri.001G466066 [exp]	270.63	0.6959

Compare expression of checked genes

Potri.014G145550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.