Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-XTR7.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23730 450 / 2e-161 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 445 / 2e-159 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT5G57560 389 / 2e-137 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT4G25810 388 / 6e-137 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57550 384 / 3e-135 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30270 373 / 3e-131 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G48070 366 / 2e-128 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT5G57530 364 / 1e-127 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57540 360 / 6e-126 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT2G18800 357 / 3e-124 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G236200 [exp] 533 / 0 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G060500 [exp] 453 / 1e-162 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201200 [exp] 445 / 2e-159 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.005G201250 [exp] 444 / 6e-159 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 438 / 9e-157 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.011G077320 [exp] 424 / 2e-151 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 421 / 3e-149 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 411 / 3e-146 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 411 / 5e-146 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028947 [exp] 444 / 3e-159 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10000678 [exp] 436 / 6e-156 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10021638 [exp] 428 / 7e-153 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10008522 [exp] 425 / 1e-151 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10004723 [exp] 425 / 2e-151 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 409 / 4e-145 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 405 / 8e-144 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 404 / 4e-143 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031392 [exp] 403 / 9e-143 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 402 / 2e-142 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.014G146100.1 pacid=42763218 polypeptide=Potri.014G146100.1.p locus=Potri.014G146100 ID=Potri.014G146100.1.v4.1 annot-version=v4.1 ATGGGGTTGTTTTGTAATGGATTCTCCTTGTTTGTGATAGTATGCTCTATGGCGGTGGTTGCTTCAGGCAACTTCTATCAGGATTTTGACTTAACATGGG GTGACCGACGTGCAAAGATATTCAACGGAGGACAGCTTCTGTCTTTGTCTCTAGACAAGGTTTCTGGGTCTGGATTTCAGTCCAAGAAGGAGTACTTGTT CGGGAGGATTGATATGCAGCTCAAACTTGTCGCTGGCAACTCTGCTGGCACTGTAACAGCCTACTATTTGTCTTCGCAAGGACCAACGCATGACGAGATC GACTTCGAGTTCTTGGGAAACCTTAGTGGCGACCCTTATATTTTGCACACTAACGTATTCACTCAGGGGAAGGGAAACAGAGAGCAGCAATTCTATCTCT GGTTTGACCCCACGAGGAACTTCCACACTTACTCCATCATCTGGAATCCTCAGCACATCATCTTCTTGGTGGACAGTATTCCCATCAGGGTGTTCAAAAA TGCTGAATCAATTGGAGTTCCATTTCCCAAGAGCCAACCCATGAGGATTTACTCTAGCCTCTGGAATGCTGATGACTGGGCTACAAGAGGTGGATTGGTC AAAACTGACTGGACTAAGGCGCCCTTCACCGCATACTATAGAAACTTCAAGGCCAATGCCTGTACTTGGTCTTACGGTACTTCTTCTTGTGGTTCCAAGC CTTCCAGCGCTTTCTCTGACGGTGCATGGAAAACCAATGAGCTTGATGCTCCAAGTAGAAGAAGACTGAGATGGGTTCAGAAATATTTCATGATTTACAA CTACTGCACTGACCTGAGACGCTTCCCTCAGGGTCCCCCTCCTGAGTGCAAATAG
AA sequence Show only first row Show all	>Potri.014G146100.1 pacid=42763218 polypeptide=Potri.014G146100.1.p locus=Potri.014G146100 ID=Potri.014G146100.1.v4.1 annot-version=v4.1 MGLFCNGFSLFVIVCSMAVVASGNFYQDFDLTWGDRRAKIFNGGQLLSLSLDKVSGSGFQSKKEYLFGRIDMQLKLVAGNSAGTVTAYYLSSQGPTHDEI DFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIIWNPQHIIFLVDSIPIRVFKNAESIGVPFPKSQPMRIYSSLWNADDWATRGGLV KTDWTKAPFTAYYRNFKANACTWSYGTSSCGSKPSSAFSDGAWKTNELDAPSRRRLRWVQKYFMIYNYCTDLRRFPQGPPPECK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Potri.014G146100 [exp]	0	1	Pt-XTR7.1
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G071200 [exp]	1.00	0.8532	Pt-EXT.6
AT5G44670			Domain of unknown function (DU...		Potri.001G074600 [exp]	5.09	0.7238
AT3G14470			NB-ARC domain-containing disea...		Potri.003G201900 [exp]	8.83	0.7391
AT5G04020			calmodulin binding (.1)		Potri.016G041100 [exp]	10.58	0.7237
AT5G44130		FLA13	FASCICLIN-like arabinogalactan...		Potri.019G093300 [exp]	17.57	0.7822	2,Pt-FLA9.2
AT5G12890			UDP-Glycosyltransferase superf...		Potri.017G077400 [exp]	18.84	0.7479
AT3G23820		GAE6	UDP-D-glucuronate 4-epimerase ...		Potri.001G320000 [exp]	20.32	0.6658	GAE6.1
AT4G35470		PIRL4, DREB1C	plant intracellular ras group-...		Potri.005G098600 [exp]	21.93	0.6858
AT4G05350			RING/U-box superfamily protein...		Potri.019G086500 [exp]	25.41	0.6857
AT5G55730		FLA1	FASCICLIN-like arabinogalactan...		Potri.001G367900 [exp]	27.74	0.6880

Compare expression of checked genes

Potri.014G146100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.