Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) AT4G29390 97 / 5e-29 Ribosomal protein S30 family protein (.1) AT2G19750 97 / 5e-29 Ribosomal protein S30 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G086600 [exp] 100 / 2e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) Potri.015G084700 [exp] 100 / 2e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002508 [exp] 100 / 4e-30 AT4G29390 98 / 4e-29 Ribosomal protein S30 family protein (.1) Lus10017473 [exp] 100 / 4e-30 AT5G56670 98 / 4e-29 Ribosomal protein S30 family protein (.1) Lus10028808 [exp] 76 / 3e-20 AT5G56670 73 / 3e-19 Ribosomal protein S30 family protein (.1) Lus10019054 [exp] 50 / 6e-09 AT5G56670 48 / 1e-07 Ribosomal protein S30 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04758 [poplar] [flax] Ribosomal_S30 Ribosomal protein S30
Representative CDS sequence Show only first row Show all	>Potri.014G147200.1 pacid=42764514 polypeptide=Potri.014G147200.1.p locus=Potri.014G147200 ID=Potri.014G147200.1.v4.1 annot-version=v4.1 ATGGGCAAGGTACACGGATCGCTGGCTCGTGCAGGGAAGGTGAGAGGTCAAACCCCAAAAGTGGCCAAGCAAGATAAGAAGAAGAAGCCTAGAGGCCGTG CCCACAAGCGCATGCAGTACAATCGCCGCTTTGTCACCGCCGTTGTTGGATTTGGGAAGAAGCGTGGACCAAACTCTTCTGAGAAGTAA
AA sequence Show only first row Show all	>Potri.014G147200.1 pacid=42764514 polypeptide=Potri.014G147200.1.p locus=Potri.014G147200 ID=Potri.014G147200.1.v4.1 annot-version=v4.1 MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G56670			Ribosomal protein S30 family p...		Potri.014G147200 [exp]	0	1
AT5G56670			Ribosomal protein S30 family p...		Potri.015G084700 [exp]	1.41	0.9347	RPS30.1
AT4G31985			Ribosomal protein L39 family p...		Potri.018G022100 [exp]	2.82	0.9230
AT3G06700			Ribosomal L29e protein family ...		Potri.010G142001 [exp]	3.74	0.9167
AT4G39200			Ribosomal protein S25 family p...		Potri.004G157200 [exp]	5.65	0.9045
AT1G15250			Zinc-binding ribosomal protein...		Potri.006G243300 [exp]	6.70	0.9250
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Potri.008G050200 [exp]	10.86	0.9276
AT2G41840			Ribosomal protein S5 family pr...		Potri.016G055000 [exp]	15.49	0.9187	Pt-RPS2.3
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.016G069000 [exp]	18.84	0.9191
AT5G40080			Mitochondrial ribosomal protei...		Potri.006G070700 [exp]	19.36	0.8728
AT5G56670			Ribosomal protein S30 family p...		Potri.012G086600 [exp]	19.36	0.8996	RPS30.2

Compare expression of checked genes

Potri.014G147200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.