Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13340 125 / 6e-35 Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G56190 125 / 1e-34 Transducin/WD40 repeat-like superfamily protein (.1.2) AT1G55680 122 / 1e-33 Transducin/WD40 repeat-like superfamily protein (.1) AT1G78070 100 / 1e-25 Transducin/WD40 repeat-like superfamily protein (.1) AT1G36070 83 / 3e-19 Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G147400 [exp] 225 / 3e-73 AT3G13340 605 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.002G233700 [exp] 200 / 1e-63 AT3G13340 597 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.006G000500 [exp] 135 / 2e-38 AT3G13340 683 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.011G168600 [exp] 133 / 5e-38 AT3G13340 736 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.001G471800 [exp] 128 / 4e-36 AT3G13340 736 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.002G094100 [exp] 113 / 3e-30 AT1G78070 655 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G168600 [exp] 109 / 5e-29 AT1G78070 649 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021975 [exp] 167 / 2e-50 AT5G56190 617 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10041268 [exp] 159 / 8e-48 AT3G13340 605 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10035667 [exp] 120 / 6e-33 AT1G55680 684 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10037252 [exp] 120 / 8e-33 AT1G55680 685 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10041102 [exp] 108 / 2e-28 AT1G78070 622 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Lus10036428 [exp] 107 / 5e-28 AT1G78070 598 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.014G147500.3 pacid=42762356 polypeptide=Potri.014G147500.3.p locus=Potri.014G147500 ID=Potri.014G147500.3.v4.1 annot-version=v4.1 ATGTCCTACTACCAGCGGTTGGGGGATATGAATTACATGGCGGAAGAGGCAGAAATGGTCGATTTCGTCGATGAAATGGATGGAGGAGCCGCCGGCGGTG TGGAAGATGTTGAAGCCAATGAATACAACTTGCTTACCAAGGCTACGGATACATCTTCTGGGCAGGCCAGGAATGGGCAAGACATACAGGGTATTCCCTG GGAAAGATTGAATATAACCAGGGAAAAATACAGATTGACCAGGCTTGAGCAGTACAAGAATTATGAGACCATTCCATTATCCGGCGAAGCTGTCAATAAG GAGTGCAAACAAATGGAGAAGGGAGGCTACTACTATGAATTCTTCCATAATACTAGATCAGTTAAGCCCACTATACTTCATTTTCAGGTTTGTGGATTTT GCAACTTCTGTATGTGA
AA sequence Show only first row Show all	>Potri.014G147500.3 pacid=42762356 polypeptide=Potri.014G147500.3.p locus=Potri.014G147500 ID=Potri.014G147500.3.v4.1 annot-version=v4.1 MSYYQRLGDMNYMAEEAEMVDFVDEMDGGAAGGVEDVEANEYNLLTKATDTSSGQARNGQDIQGIPWERLNITREKYRLTRLEQYKNYETIPLSGEAVNK ECKQMEKGGYYYEFFHNTRSVKPTILHFQVCGFCNFCM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13340			Transducin/WD40 repeat-like su...		Potri.014G147500 [exp]	0	1
AT1G63500			Protein kinase protein with te...		Potri.003G126700 [exp]	3.87	0.8486
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.009G113045 [exp]	4.89	0.8289
AT3G47500	DOF	CDF3, AtDof3,3	cycling DOF factor 3 (.1)		Potri.013G066700 [exp]	6.32	0.8166
					Potri.017G019932 [exp]	6.92	0.8323
AT5G58003		CPL4	C-terminal domain phosphatase-...		Potri.018G108300 [exp]	6.92	0.8277
AT1G76900	TUB	AtTLP1	tubby like protein 1 (.1.2)		Potri.005G192400 [exp]	7.74	0.8150
AT3G54440			glycoside hydrolase family 2 p...		Potri.001G027400 [exp]	12.68	0.8131
AT1G26110		DCP5	decapping 5 (.1.2)		Potri.017G111500 [exp]	17.60	0.8045
AT4G32030			unknown protein		Potri.006G259700 [exp]	18.97	0.7600
AT5G36930			Disease resistance protein (TI...		Potri.019G001600 [exp]	21.16	0.7912

Compare expression of checked genes

Potri.014G147500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.