Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05510 64 / 8e-14 Protein of unknown function (DUF1264) (.1) AT2G31985 61 / 7e-13 Protein of unknown function (DUF1264) (.1) AT5G45690 37 / 0.0002 Protein of unknown function (DUF1264) (.1) AT4G18920 36 / 0.0006 Protein of unknown function (DUF1264) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022586 [exp] 67 / 4e-15 AT1G05510 331 / 6e-116 Protein of unknown function (DUF1264) (.1) Lus10021483 [exp] 58 / 4e-12 AT1G05510 140 / 6e-42 Protein of unknown function (DUF1264) (.1) Lus10005416 [exp] 50 / 1e-09 AT5G45690 109 / 5e-31 Protein of unknown function (DUF1264) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06884 [poplar] [flax] DUF1264 Protein of unknown function (DUF1264)
Representative CDS sequence Show only first row Show all	>Potri.014G148050.1 pacid=42763531 polypeptide=Potri.014G148050.1.p locus=Potri.014G148050 ID=Potri.014G148050.1.v4.1 annot-version=v4.1 ATGTCAGCTCATCCAGATGTTCCCGGCGAGCCAACAACTGGCACGGCTCTCCTTGAGACGGCCACAGCTGCCGTTCAAAGCTTTGGTCCTGCTAAGAAAA TCCACCAACACCTCTGCGCATTTCACTTTTATTCACATGACATGACTCGGCAAGTAGAGGCGCATCATTTTTTGTGGCCACCAGAACGAGGAAATGCGCC AATGCCTGATATACAGTAG
AA sequence Show only first row Show all	>Potri.014G148050.1 pacid=42763531 polypeptide=Potri.014G148050.1.p locus=Potri.014G148050 ID=Potri.014G148050.1.v4.1 annot-version=v4.1 MSAHPDVPGEPTTGTALLETATAAVQSFGPAKKIHQHLCAFHFYSHDMTRQVEAHHFLWPPERGNAPMPDIQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05510			Protein of unknown function (D...		Potri.014G148050 [exp]	0	1
					Potri.015G054900 [exp]	12.12	0.9586
AT5G67070		RALFL34	ralf-like 34 (.1)		Potri.014G026900 [exp]	17.23	0.9268
AT3G55090		ABCG16	ATP-binding cassette G16, ABC-...		Potri.010G213400 [exp]	18.81	0.9481	2
AT2G01505		CLE16	CLAVATA3/ESR-RELATED 16 (.1)		Potri.008G130800 [exp]	19.44	0.9501
					Potri.011G073116 [exp]	26.68	0.9478
					Potri.014G075251 [exp]	29.83	0.9478
AT2G18360			alpha/beta-Hydrolases superfam...		Potri.009G116900 [exp]	31.60	0.9243
AT4G33355			Bifunctional inhibitor/lipid-t...		Potri.014G046500 [exp]	32.68	0.9478
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128400 [exp]	35.79	0.9476
AT1G33811			GDSL-like Lipase/Acylhydrolase...		Potri.013G102400 [exp]	37.94	0.9475

Compare expression of checked genes

Potri.014G148050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.