Potri.014G148600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42820 87 / 6e-23 HVA22F HVA22-like protein F (.1)
AT5G62490 87 / 1e-22 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1)
AT1G74520 87 / 2e-22 ATHVA22A HVA22 homologue A (.1)
AT5G50720 84 / 5e-22 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
AT4G24960 79 / 1e-19 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3)
AT1G69700 74 / 3e-17 ATHVA22C HVA22 homologue C (.1)
AT5G42560 47 / 3e-07 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
AT1G75700 42 / 2e-05 HVA22G HVA22-like protein G (.1)
AT4G36720 40 / 7e-05 HVA22K HVA22-like protein K (.1)
AT1G19950 40 / 0.0001 HVA22H HVA22-like protein H (ATHVA22H) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G006000 100 / 1e-27 AT2G42820 235 / 1e-80 HVA22-like protein F (.1)
Potri.012G101600 91 / 3e-24 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
Potri.015G062800 89 / 2e-23 AT1G74520 255 / 4e-88 HVA22 homologue A (.1)
Potri.012G069300 89 / 3e-23 AT1G74520 259 / 1e-89 HVA22 homologue A (.1)
Potri.015G099700 86 / 2e-22 AT5G50720 166 / 5e-54 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
Potri.005G152100 48 / 3e-07 AT1G69700 102 / 1e-25 HVA22 homologue C (.1)
Potri.007G029300 46 / 8e-07 AT4G36720 252 / 2e-85 HVA22-like protein K (.1)
Potri.009G078500 46 / 1e-06 AT1G74520 104 / 6e-26 HVA22 homologue A (.1)
Potri.017G139000 44 / 4e-06 AT1G74520 119 / 5e-32 HVA22 homologue A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031386 94 / 2e-25 AT2G42820 246 / 4e-85 HVA22-like protein F (.1)
Lus10010944 92 / 2e-24 AT2G42820 246 / 7e-85 HVA22-like protein F (.1)
Lus10023605 88 / 2e-22 AT1G74520 246 / 7e-84 HVA22 homologue A (.1)
Lus10024234 88 / 2e-22 AT1G74520 244 / 5e-83 HVA22 homologue A (.1)
Lus10032557 83 / 3e-21 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
Lus10043186 82 / 9e-21 AT5G50720 169 / 1e-55 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1)
Lus10042193 82 / 3e-19 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Lus10037191 77 / 3e-18 AT1G69700 231 / 6e-78 HVA22 homologue C (.1)
Lus10008623 73 / 4e-17 AT1G74520 234 / 5e-80 HVA22 homologue A (.1)
Lus10024332 42 / 2e-05 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03134 TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence
>Potri.014G148600.1 pacid=42763012 polypeptide=Potri.014G148600.1.p locus=Potri.014G148600 ID=Potri.014G148600.1.v4.1 annot-version=v4.1
ATGGGTCTTCTTGGAGCAGTTTTTTCAATTGTGAATGCACTAGTTCTACCAATACTAGGGCCTGCAACAATGTTTCTTTATCCAGCCTATGCATCAATTC
AAGCAATTGAAAGGCCTTCACATCGAGACAACAAGCAGTGGTTATCATATTGGATTCTATATTCATTTATATCCCTCTTCGAGATAACATTTCTGGTATT
TCTTCAATGGTTTCCATTGTGGGGACTGATCAAGCTTCTGGTTCATTTGTGGTTAGTGCTACCTGTTTTCAATGGGGCAACTTTTGTTTATGAGAATTAC
ATGCGGGACTACAGAAAGCTTAATGGCTTATTAAACGACTTGAGAAAAATGATCCCTGGTGAAGGATTTTAA
AA sequence
>Potri.014G148600.1 pacid=42763012 polypeptide=Potri.014G148600.1.p locus=Potri.014G148600 ID=Potri.014G148600.1.v4.1 annot-version=v4.1
MGLLGAVFSIVNALVLPILGPATMFLYPAYASIQAIERPSHRDNKQWLSYWILYSFISLFEITFLVFLQWFPLWGLIKLLVHLWLVLPVFNGATFVYENY
MRDYRKLNGLLNDLRKMIPGEGF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G62490 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOM... Potri.014G148600 0 1
AT3G14260 Protein of unknown function (D... Potri.003G125300 22.04 0.8786
AT2G01950 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like ... Potri.010G058850 25.15 0.8739
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Potri.018G033600 31.24 0.8708 GA3ox4,Pt-WGA3.2
AT5G39840 ATP-dependent RNA helicase, mi... Potri.017G081900 34.49 0.8669
AT3G47570 Leucine-rich repeat protein ki... Potri.018G120901 39.19 0.8655
Potri.010G137500 42.21 0.8637
Potri.010G007402 42.57 0.8654
Potri.004G216400 45.43 0.8649
AT4G16295 SPH1 S-protein homologue 1 (.1) Potri.002G252500 45.71 0.8325
AT4G33230 Plant invertase/pectin methyle... Potri.003G021300 46.36 0.8624

Potri.014G148600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.