Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ARA.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31680 373 / 2e-133 AtRABA5d RAB GTPase homolog A5D (.1) AT1G05810 369 / 4e-131 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT2G43130 361 / 1e-128 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G07410 342 / 8e-121 AtRABA5b RAB GTPase homolog A5B (.1) AT5G47520 284 / 6e-98 AtRABA5a RAB GTPase homolog A5A (.1) AT4G18430 247 / 2e-83 AtRABA1e RAB GTPase homolog A1E (.1) AT1G09630 245 / 1e-82 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT5G60860 244 / 2e-82 AtRABA1f RAB GTPase homolog A1F (.1) AT5G47960 244 / 4e-82 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT1G07410 243 / 4e-82 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G231800 [exp] 436 / 3e-158 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 331 / 1e-116 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.016G010300 [exp] 285 / 2e-98 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G015400 [exp] 280 / 2e-96 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.003G004100 [exp] 253 / 9e-86 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.010G197200 [exp] 248 / 5e-84 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 246 / 4e-83 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.001G270100 [exp] 246 / 5e-83 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.013G123600 [exp] 245 / 8e-83 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026731 [exp] 389 / 2e-139 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 389 / 2e-139 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038226 [exp] 313 / 2e-109 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10025876 [exp] 313 / 2e-109 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10000536 [exp] 289 / 8e-100 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10038807 [exp] 285 / 2e-98 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 285 / 2e-98 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10000637 [exp] 252 / 4e-85 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10023153 [exp] 251 / 7e-85 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 249 / 3e-84 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.014G150300.1 pacid=42763985 polypeptide=Potri.014G150300.1.p locus=Potri.014G150300 ID=Potri.014G150300.1.v4.1 annot-version=v4.1 ATGTCATCAGACGAGGAAGGAGGAGAGGAGTACTTGTTCAAGATCGTGATAATTGGGGATTCTGCAGTGGGAAAATCAAATCTACTTTCTCGATATGCAA GAAATGAGTTCAATTTGCATTCAAAAGCCACAATAGGAGTGGAGTTTCAGACCCAGAGCATGGAAATTGATGGAAAAGAAGTTAAGGCTCAGATTTGGGA CACTGCCGGTCAAGAGAGGTTTAGGGCTGTTACTTCCGCTTACTATAGAGGTGCTGTCGGTGCTCTCATTGTTTATGATATCAGTCGCCGTACTACTTTT GATAGTGTCGGTCGATGGCTTGATGAGCTTAAAACCCATTCAGATACAACTGTAGCAATGATGCTGGTTGGAAACAAATGTGATTTGGAGAATATCAGGG ATGTTAGTGTGGAGGAAGCCAAATGCCTCGCAGAAGCAGAAGGCTTATTCTTCATGGAAACATCTGCCCTTGACTCAACAAATGTTAAGAAGGCTTTTGA GATTGTTATTCGAGAGATATACAACAATGTGAGCAGGAAGGTCTTGAATTCTGATACATACAAAGCTGAATTGTCTCTGAATAGGGTAACCCTTGTTAAT AATGGGAATGATTCCAAGCAAGCTCAGAGCTACTTTTCCTGCTGCTCCAGGTGA
AA sequence Show only first row Show all	>Potri.014G150300.1 pacid=42763985 polypeptide=Potri.014G150300.1.p locus=Potri.014G150300 ID=Potri.014G150300.1.v4.1 annot-version=v4.1 MSSDEEGGEEYLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTF DSVGRWLDELKTHSDTTVAMMLVGNKCDLENIRDVSVEEAKCLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAELSLNRVTLVN NGNDSKQAQSYFSCCSR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31680		AtRABA5d	RAB GTPase homolog A5D (.1)		Potri.014G150300 [exp]	0	1	ARA.2
AT1G31812		ACBP6, ACBP	acyl-CoA-binding protein 6 (.1...		Potri.003G103700 [exp]	17.23	0.8215
AT5G37660		PDLP7	plasmodesmata-located protein ...		Potri.017G130800 [exp]	18.73	0.8454
					Potri.004G156500 [exp]	22.44	0.8694
AT3G27050			unknown protein		Potri.001G329600 [exp]	31.06	0.7780
AT1G22540			Major facilitator superfamily ...		Potri.013G106600 [exp]	43.95	0.7989
AT1G10370		GST30B, ATGSTU1...	GLUTATHIONE S-TRANSFERASE U17,...		Potri.010G035500 [exp]	44.82	0.8516	Pt-GST30.1
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Potri.007G022700 [exp]	52.07	0.7904
AT3G53420		PIP2;1, PIP2A	PLASMA MEMBRANE INTRINSIC PROT...		Potri.008G039600 [exp]	52.53	0.8271	Pt-MDPIP1.2
AT3G23490		CYN	cyanase (.1)		Potri.010G068200 [exp]	52.63	0.7627	Pt-CYN.1
AT5G51110			Transcriptional coactivator/pt...		Potri.012G112400 [exp]	61.23	0.8415

Compare expression of checked genes

Potri.014G150300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.