Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32540 90 / 1e-21 ATCSLB4, ATCSLB04 CELLULOSE SYNTHASE LIKE B4, cellulose synthase-like B4 (.1) AT2G32530 86 / 5e-20 ATCSLB3, ATCSLB03 cellulose synthase-like B3 (.1) AT2G32620 74 / 7e-16 ATCSLB2, ATCSLB02 CELLULOSE SYNTHASE LIKE B2, cellulose synthase-like B (.1) AT4G24010 72 / 2e-15 CSLG2, ATCSLG1 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE LIKE G1, cellulose synthase like G1 (.1) AT2G32610 71 / 5e-15 ATCSLB1, ATCSLB01 CELLULOSE SYNTHASE LIKE B1, cellulose synthase-like B1 (.1) AT4G15290 66 / 3e-13 ATCSLB5, ATCSLB05 CELLULOSE SYNTHASE LIKE 5, Cellulose synthase family protein (.1) AT4G24000 66 / 5e-13 ATCSLG2 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE LIKE G2, cellulose synthase like G2 (.1) AT4G23990 66 / 5e-13 ATCSLG3 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) AT5G05170 60 / 3e-11 IXR1, CEV1, ATH-B, ATCESA3, CESA3 ISOXABEN RESISTANT 1, CONSTITUTIVE EXPRESSION OF VSP 1, CELLULOSE SYNTHASE 3, Cellulose synthase family protein (.1) AT4G32410 59 / 6e-11 AtCESA1, RSW1, CESA1 RADIALLY SWOLLEN 1, cellulose synthase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G155300 [exp] 239 / 7e-76 AT2G32540 711 / 0.0 CELLULOSE SYNTHASE LIKE B4, cellulose synthase-like B4 (.1) Potri.002G227300 [exp] 218 / 9e-68 AT2G32540 712 / 0.0 CELLULOSE SYNTHASE LIKE B4, cellulose synthase-like B4 (.1) Potri.003G142500 [exp] 63 / 4e-12 AT4G23990 809 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Potri.003G142400 [exp] 60 / 3e-11 AT4G23990 850 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Potri.018G103900 [exp] 58 / 2e-10 AT5G17420 1730 / 0.0 MURUS 10, IRREGULAR XYLEM 3, CELLULOSE SYNTHASE CATALYTIC SUBUNIT 7, Cellulose synthase family protein (.1) Potri.006G181900 [exp] 58 / 2e-10 AT5G17420 1730 / 0.0 MURUS 10, IRREGULAR XYLEM 3, CELLULOSE SYNTHASE CATALYTIC SUBUNIT 7, Cellulose synthase family protein (.1) Potri.009G060800 [exp] 58 / 3e-10 AT5G05170 1838 / 0.0 ISOXABEN RESISTANT 1, CONSTITUTIVE EXPRESSION OF VSP 1, CELLULOSE SYNTHASE 3, Cellulose synthase family protein (.1) Potri.013G019800 [exp] 57 / 3e-10 AT5G64740 1512 / 0.0 PROCUSTE 1, ISOXABEN RESISTANT 2, cellulose synthase 6 (.1) Potri.005G027600 [exp] 57 / 3e-10 AT5G64740 1506 / 0.0 PROCUSTE 1, ISOXABEN RESISTANT 2, cellulose synthase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030035 [exp] 114 / 6e-30 AT2G32540 669 / 0.0 CELLULOSE SYNTHASE LIKE B4, cellulose synthase-like B4 (.1) Lus10023056 [exp] 62 / 8e-12 AT4G23990 776 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Lus10039607 [exp] 59 / 2e-10 AT5G05170 1820 / 0.0 ISOXABEN RESISTANT 1, CONSTITUTIVE EXPRESSION OF VSP 1, CELLULOSE SYNTHASE 3, Cellulose synthase family protein (.1) Lus10018902 [exp] 58 / 2e-10 AT4G32410 1915 / 0.0 RADIALLY SWOLLEN 1, cellulose synthase 1 (.1) Lus10028597 [exp] 58 / 2e-10 AT4G32410 1922 / 0.0 RADIALLY SWOLLEN 1, cellulose synthase 1 (.1) Lus10012198 [exp] 56 / 1e-09 AT5G05170 1774 / 0.0 ISOXABEN RESISTANT 1, CONSTITUTIVE EXPRESSION OF VSP 1, CELLULOSE SYNTHASE 3, Cellulose synthase family protein (.1) Lus10007538 [exp] 56 / 1e-09 AT5G05170 1772 / 0.0 ISOXABEN RESISTANT 1, CONSTITUTIVE EXPRESSION OF VSP 1, CELLULOSE SYNTHASE 3, Cellulose synthase family protein (.1) Lus10008226 [exp] 56 / 1e-09 AT5G44030 821 / 0.0 IRREGULAR XYLEM 5, cellulose synthase A4 (.1) Lus10022449 [exp] 55 / 3e-09 AT4G18780 1286 / 0.0 LEAF WILTING 2, IRREGULAR XYLEM 1, CELLULOSE SYNTHASE 8, cellulose synthase family protein (.1) Lus10023057 [exp] 55 / 3e-09 AT4G23990 816 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0110 [poplar] [flax] GT-A PF03552 [poplar] [flax] Cellulose_synt Cellulose synthase
Representative CDS sequence Show only first row Show all	>Potri.014G155401.1 pacid=42763828 polypeptide=Potri.014G155401.1.p locus=Potri.014G155401 ID=Potri.014G155401.1.v4.1 annot-version=v4.1 ATGGCACCACCGTGTCAACCACCACCAATGACCAAGTTCTTGACATACTTCATTAAGGTCCATGAGCCAGCCATATATGTTTATGTGGCCCTTTTCCTGT GTTATGTCATCTACACTCTAATAGAGTACCTTGAAACTGGATTGTCAATCCGTGCATGGTGGAATAACCAAAGGATGGCAAGAATAAACACAATGAATGC ATGGTTATTTGGAGTCATAAGTGTAATCTTGAAGGTTTTAAGAATATCAGATACAGTTTTTGAAGTTACACTGAAAGACCAATCTTCAAATAATGATGGC GATGAAGGCAGGTTCACCTTCGATGCTTCACTGATTTTTGTGCCTGGGACAGCCGTTCTGCTTCTGCAACTCACGGCATTGATCATGGGCTTCCAAGGAA TGCAACTATCAGTGAACGATGGCTCAGGGCTGGGAGGGATATTGCATGTGTAG
AA sequence Show only first row Show all	>Potri.014G155401.1 pacid=42763828 polypeptide=Potri.014G155401.1.p locus=Potri.014G155401 ID=Potri.014G155401.1.v4.1 annot-version=v4.1 MAPPCQPPPMTKFLTYFIKVHEPAIYVYVALFLCYVIYTLIEYLETGLSIRAWWNNQRMARINTMNAWLFGVISVILKVLRISDTVFEVTLKDQSSNNDG DEGRFTFDASLIFVPGTAVLLLQLTALIMGFQGMQLSVNDGSGLGGILHV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32540		ATCSLB4, ATCSLB...	CELLULOSE SYNTHASE LIKE B4, ce...		Potri.014G155401 [exp]	0	1
AT1G10417			unknown protein		Potri.008G190600 [exp]	3.16	0.9042
AT4G25170			Uncharacterised conserved prot...		Potri.001G126300 [exp]	4.24	0.8954
AT1G32790		CID11	CTC-interacting domain 11 (.1....		Potri.001G448800 [exp]	4.69	0.9120
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116050 [exp]	5.19	0.8877
AT3G62470			Pentatricopeptide repeat (PPR)...		Potri.008G191200 [exp]	5.65	0.8557
AT5G06710	HD	HAT14	homeobox from Arabidopsis thal...		Potri.016G058600 [exp]	6.70	0.8491
AT2G45740		PEX11D	peroxin 11D (.1.2.3)		Potri.009G133900 [exp]	6.70	0.8794
AT5G01310	bHLH	APTX, bHLH140	APRATAXIN-like (.1)		Potri.016G120200 [exp]	11.74	0.8912
					Potri.007G010000 [exp]	13.41	0.8930
AT1G71090			Auxin efflux carrier family pr...		Potri.008G127700 [exp]	13.49	0.8594

Compare expression of checked genes

Potri.014G155401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.