Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32580 245 / 9e-84 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) AT1G05070 239 / 3e-81 Protein of unknown function (DUF1068) (.1) AT4G04360 194 / 1e-63 Protein of unknown function (DUF1068) (.1) AT2G24290 155 / 2e-48 Protein of unknown function (DUF1068) (.1) AT4G30996 144 / 3e-44 NKS1 NA\(+\)- AND K\(+\)-SENSITIVE 1, Protein of unknown function (DUF1068) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G227100 [exp] 325 / 2e-115 AT2G32580 218 / 6e-73 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Potri.004G006500 [exp] 219 / 4e-73 AT2G32580 206 / 6e-68 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Potri.018G111100 [exp] 134 / 5e-40 AT4G30996 208 / 2e-69 NA\(+\)- AND K\(+\)-SENSITIVE 1, Protein of unknown function (DUF1068) (.1) Potri.006G187800 [exp] 133 / 9e-40 AT4G30996 198 / 1e-65 NA\(+\)- AND K\(+\)-SENSITIVE 1, Protein of unknown function (DUF1068) (.1) Potri.005G038000 [exp] 120 / 7e-35 AT1G05070 110 / 7e-31 Protein of unknown function (DUF1068) (.1) Potri.013G026900 [exp] 118 / 1e-33 AT2G24290 114 / 2e-32 Protein of unknown function (DUF1068) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030034 [exp] 268 / 1e-92 AT1G05070 250 / 1e-85 Protein of unknown function (DUF1068) (.1) Lus10035288 [exp] 268 / 2e-92 AT1G05070 252 / 1e-86 Protein of unknown function (DUF1068) (.1) Lus10015556 [exp] 201 / 3e-66 AT1G05070 179 / 4e-58 Protein of unknown function (DUF1068) (.1) Lus10020038 [exp] 179 / 6e-58 AT1G05070 167 / 4e-53 Protein of unknown function (DUF1068) (.1) Lus10019053 [exp] 129 / 3e-38 AT2G24290 259 / 1e-89 Protein of unknown function (DUF1068) (.1) Lus10036299 [exp] 127 / 4e-37 AT2G24290 257 / 1e-88 Protein of unknown function (DUF1068) (.1) Lus10035349 [exp] 84 / 4e-20 AT2G32580 110 / 2e-30 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Lus10029975 [exp] 78 / 6e-18 AT2G32580 109 / 3e-30 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06364 [poplar] [flax] DUF1068 Protein of unknown function (DUF1068)
Representative CDS sequence Show only first row Show all	>Potri.014G155600.1 pacid=42763884 polypeptide=Potri.014G155600.1.p locus=Potri.014G155600 ID=Potri.014G155600.1.v4.1 annot-version=v4.1 ATGGCAACGAAGCAGCAGCAAGCGGCAGTGGTGGGGTTGGGGTTAATGGCAGTGTGTATAGCAGGATACATATTGGGCCCACCACTCTACTGGCACTTGA AAGAAGGATTTGTTGCCGTCGCTCGATCTTCTCCGAATTGCTCTCCTTGTCTCTGTGATTGCTCTTCTCAGCCTCTCCTCTCCATTCCTCAAGGATTGAG CAATGCATCCTTCACAGATTGTGCGAAGCATGACCCAGAGGTGACTGAAGATGCTGAGAAGAACTTTGCAGAGCTACTGAAAGAGGAATTGCAGCTGCGG GAAACTGAAGCACTAGAGAATCAGCGGCGAGCTGATATAGTTCTGCTTGAGGCTAAGAAGATGACATCCCAGTATCAAAAGGAAGCTGACAAATGCAATT CAGGGATGGAAACCTGTGAAGAAGCAAGGGAGAAATCTGAAGCCGCATTAGTAGCACAAAAGAAATTGACAGCAATGTGGGAGCTGAGGGCGCGTCAGAG AGGATGGAAAGATGAGGTTGCCAAGTCCCATACCCACTCTCAGGGGAATGTTCAATCCACGTAA
AA sequence Show only first row Show all	>Potri.014G155600.1 pacid=42763884 polypeptide=Potri.014G155600.1.p locus=Potri.014G155600 ID=Potri.014G155600.1.v4.1 annot-version=v4.1 MATKQQQAAVVGLGLMAVCIAGYILGPPLYWHLKEGFVAVARSSPNCSPCLCDCSSQPLLSIPQGLSNASFTDCAKHDPEVTEDAEKNFAELLKEELQLR ETEALENQRRADIVLLEAKKMTSQYQKEADKCNSGMETCEEAREKSEAALVAQKKLTAMWELRARQRGWKDEVAKSHTHSQGNVQST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32580			Protein of unknown function (D...		Potri.014G155600 [exp]	0	1
AT3G44150			unknown protein		Potri.016G068000 [exp]	1.41	0.9658
AT3G07950			rhomboid protein-related (.1)		Potri.010G220900 [exp]	1.73	0.9532
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Potri.010G222000 [exp]	2.23	0.9459	VMA10.2
AT1G51160			SNARE-like superfamily protein...		Potri.017G149900 [exp]	2.44	0.9533
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.004G156900 [exp]	3.00	0.9391	Pt-RER1.2
AT5G15320			unknown protein		Potri.002G024900 [exp]	4.00	0.9514
AT1G34350			unknown protein		Potri.019G085500 [exp]	4.00	0.9308
AT4G28088			Low temperature and salt respo...		Potri.006G182500 [exp]	4.00	0.9397
AT3G03800		ATSYP131, SYP13...	syntaxin of plants 131 (.1)		Potri.019G036700 [exp]	5.29	0.9329	SYP131.2
AT5G35080			unknown protein		Potri.018G118200 [exp]	5.56	0.9222

Compare expression of checked genes

Potri.014G155600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.