Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32650 203 / 1e-68 RmlC-like cupins superfamily protein (.1.2) AT2G32180 203 / 2e-68 PTAC18 plastid transcriptionally active 18 (.1) AT4G10290 61 / 6e-13 RmlC-like cupins superfamily protein (.1) AT4G10300 58 / 1e-11 RmlC-like cupins superfamily protein (.1) AT3G04300 54 / 2e-10 RmlC-like cupins superfamily protein (.1) AT4G10280 55 / 4e-10 RmlC-like cupins superfamily protein (.1) AT2G27402 44 / 5e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G089600 [exp] 64 / 1e-13 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1) Potri.002G254800 [exp] 49 / 4e-08 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035307 [exp] 201 / 2e-67 AT2G32180 190 / 2e-63 plastid transcriptionally active 18 (.1) Lus10030017 [exp] 195 / 3e-65 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1) Lus10035659 [exp] 60 / 8e-12 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1) Lus10037245 [exp] 59 / 1e-11 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1) Lus10035660 [exp] 59 / 3e-11 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1) Lus10025947 [exp] 44 / 4e-06 AT4G28703 132 / 6e-41 RmlC-like cupins superfamily protein (.1) Lus10014252 [exp] 39 / 0.0001 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF05899 [poplar] [flax] Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence Show only first row Show all	>Potri.014G156900.1 pacid=42762707 polypeptide=Potri.014G156900.1.p locus=Potri.014G156900 ID=Potri.014G156900.1.v4.1 annot-version=v4.1 ATGGCAAGCGTGATCATATCCCCAACCTTCTCTGTCAACAGAAGCAGCAGAGATTGTAAAATCTTGAAAAATACTATTCGGCAATGTCAAGGTATAAAGG CGATGCACATCGAGAAGCCTCTTGAGGAGTTGTACAACGTAAGGGTGGAAAGGAAAGTGTCACGAGATAGACTGGCAGAGCTTGGGGTTTCAAAATGGTC AGTGTGGAAGACTGACAAGTGCAAATTGCCCTGGGACTGGCAGGTGGACCAGTTAGTTTACATTGAGGAAGGAGAGGTGAGGGTAGTTCCTGAAGGGAGC AAAAAATACATGCGATTTGTTGCAGGAGACCTTGTTCGCTACCCAAAGTGGTTTGAGGCTGACCTCTTTTTCAATGCTCCATACCAAGAGCGATATAGTT TCCGAGCTTATGGTGATGACCACTAA
AA sequence Show only first row Show all	>Potri.014G156900.1 pacid=42762707 polypeptide=Potri.014G156900.1.p locus=Potri.014G156900 ID=Potri.014G156900.1.v4.1 annot-version=v4.1 MASVIISPTFSVNRSSRDCKILKNTIRQCQGIKAMHIEKPLEELYNVRVERKVSRDRLAELGVSKWSVWKTDKCKLPWDWQVDQLVYIEEGEVRVVPEGS KKYMRFVAGDLVRYPKWFEADLFFNAPYQERYSFRAYGDDH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32650			RmlC-like cupins superfamily p...		Potri.014G156900 [exp]	0	1
AT1G76405			unknown protein		Potri.005G255100 [exp]	1.00	0.9641
AT5G17870		PSRP6	plastid-specific 50S ribosomal...		Potri.002G112500 [exp]	3.16	0.9572
AT3G03630		CS26	cysteine synthase 26 (.1)		Potri.019G045800 [exp]	9.94	0.9505
AT4G29400			Protein of unknown function (D...		Potri.014G148300 [exp]	10.77	0.9470
					Potri.001G230200 [exp]	10.90	0.9413
AT3G04890			Uncharacterized conserved prot...		Potri.013G036500 [exp]	11.66	0.9410
AT3G06730		TRXz, TRXP ,TRX...	thioredoxin putative plastidic...		Potri.001G028500 [exp]	11.74	0.9441
AT5G66860			Ribosomal protein L25/Gln-tRNA...		Potri.005G135000 [exp]	13.63	0.9097
AT1G48460			unknown protein		Potri.014G038800 [exp]	14.14	0.9308
AT4G29660		EMB2752	embryo defective 2752 (.1)		Potri.012G001800 [exp]	14.14	0.8957

Compare expression of checked genes

Potri.014G156900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.