Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08000 129 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 100 / 3e-28 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT4G13850 90 / 4e-24 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT5G61030 89 / 4e-22 GR-RBP3 glycine-rich RNA-binding protein 3 (.1) AT1G74230 83 / 5e-20 GR-RBP5 glycine-rich RNA-binding protein 5 (.1) AT5G47320 78 / 1e-18 RPS19 ribosomal protein S19 (.1) AT4G39260 74 / 4e-18 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4) AT2G21660 74 / 1e-17 CCR2, ATGRP7, GR-RBP7 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) AT2G37220 76 / 2e-17 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G60000 76 / 2e-17 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G059000 [exp] 99 / 1e-27 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.002G225700 [exp] 96 / 2e-26 AT3G08000 64 / 1e-13 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 95 / 5e-26 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.012G061600 [exp] 97 / 2e-25 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.015G057400 [exp] 96 / 3e-25 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.001G319800 [exp] 86 / 2e-22 AT4G13850 137 / 2e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.006G208500 [exp] 81 / 1e-20 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G172100 [exp] 81 / 4e-19 AT1G60000 288 / 5e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.010G065600 [exp] 78 / 2e-18 AT1G60000 287 / 9e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031534 [exp] 154 / 2e-49 AT3G08000 146 / 2e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015146 [exp] 151 / 3e-48 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10022551 [exp] 90 / 5e-24 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10016639 [exp] 90 / 6e-24 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10034685 [exp] 93 / 7e-24 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1) Lus10021154 [exp] 93 / 1e-23 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10017852 [exp] 91 / 2e-23 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1) Lus10032591 [exp] 89 / 3e-23 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10040519 [exp] 94 / 4e-23 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1) Lus10043158 [exp] 87 / 1e-22 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.014G157300.1 pacid=42762777 polypeptide=Potri.014G157300.1.p locus=Potri.014G157300 ID=Potri.014G157300.1.v4.1 annot-version=v4.1 ATGAATAGAAATCTCATGTCAGTTGCTAGAAAAGCTTTAACAAAAGCTCACAATCCCGCCACCAATAATAAACTGTTTGTTGCAGGTTTGTCATGGTCAG TTGACGAGAAGTCATTGAAAGATGCTTTCTCTTCCTTTGGAGATGTCACGGAAGTGAATATATTGTATGATAGAAACAGTGGTAGATCAAGAGGGTTTGG TTTTGTTAGTTTCTGTAAAGAAGATGAGGCTGTATCTGCGAAAGATGCAATGGATGGAAAGGCATTGTTAGGTCGTCCATTGAGAATAAGCTATGCTCTT GAAAGAGTTCGAGGCGGACCAGTCGTTGTGCCTCGCCTTCCAAACGGAGGAGGTGAGGGCTACAACGGCAATGCTTGA
AA sequence Show only first row Show all	>Potri.014G157300.1 pacid=42762777 polypeptide=Potri.014G157300.1.p locus=Potri.014G157300 ID=Potri.014G157300.1.v4.1 annot-version=v4.1 MNRNLMSVARKALTKAHNPATNNKLFVAGLSWSVDEKSLKDAFSSFGDVTEVNILYDRNSGRSRGFGFVSFCKEDEAVSAKDAMDGKALLGRPLRISYAL ERVRGGPVVVPRLPNGGGEGYNGNA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Potri.014G157300 [exp]	0	1
AT5G62290			nucleotide-sensitive chloride ...		Potri.015G129900 [exp]	1.73	0.8361
AT3G29230			Tetratricopeptide repeat (TPR)...		Potri.004G125500 [exp]	7.34	0.8301
AT5G55140			ribosomal protein L30 family p...		Potri.002G225600 [exp]	8.30	0.8098
AT3G13160			Tetratricopeptide repeat (TPR)...		Potri.011G032400 [exp]	10.77	0.8023
AT3G52905			Polynucleotidyl transferase, r...		Potri.001G104800 [exp]	12.24	0.7971
AT2G44850			unknown protein		Potri.002G137300 [exp]	16.09	0.7959
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Potri.002G220300 [exp]	17.66	0.7805
AT5G07900			Mitochondrial transcription te...		Potri.004G013100 [exp]	18.16	0.7769
AT5G63010			Transducin/WD40 repeat-like su...		Potri.014G000900 [exp]	21.33	0.7975
AT5G66520			Tetratricopeptide repeat (TPR)...		Potri.017G141200 [exp]	23.49	0.7816

Compare expression of checked genes

Potri.014G157300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.