Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22250 103 / 2e-27 RING/U-box superfamily protein (.1) AT4G03965 100 / 1e-26 RING/U-box superfamily protein (.1) AT1G62370 99 / 4e-26 RING/U-box superfamily protein (.1) AT3G25030 95 / 4e-24 RING/U-box superfamily protein (.1.2) AT4G13100 94 / 1e-23 RING/U-box superfamily protein (.1.2.3.4.5) AT3G07120 75 / 4e-16 RING/U-box superfamily protein (.1) AT2G34920 45 / 9e-06 EDA18 embryo sac development arrest 18, RING/U-box superfamily protein (.1) AT3G06140 42 / 0.0001 RING/U-box superfamily protein (.1) AT5G23110 42 / 0.0002 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT1G30860 41 / 0.0003 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G224200 [exp] 192 / 1e-62 AT4G03965 116 / 7e-33 RING/U-box superfamily protein (.1) Potri.004G003101 [exp] 103 / 1e-27 AT4G03965 135 / 3e-39 RING/U-box superfamily protein (.1) Potri.002G243800 [exp] 97 / 7e-24 AT3G07120 191 / 3e-57 RING/U-box superfamily protein (.1) Potri.003G156400 [exp] 42 / 0.0001 AT2G34920 172 / 5e-45 embryo sac development arrest 18, RING/U-box superfamily protein (.1) Potri.005G093000 [exp] 42 / 0.0002 AT5G23110 5932 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1) Potri.004G189400 [exp] 42 / 0.0002 AT5G22750 1506 / 0.0 DNA/RNA helicase protein (.1) Potri.014G159300 [exp] 40 / 0.0004 AT2G32950 1091 / 0.0 FUSCA 1, EMBRYO DEFECTIVE 168, DEETIOLATED MUTANT 340, ARABIDOPSIS THALIANA CONSTITUTIVE PHOTOMORPHOGENIC 1, Transducin/WD40 repeat-like superfamily protein (.1) Potri.006G164516 [exp] 39 / 0.0004 AT3G46620 63 / 6e-13 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.001G251900 [exp] 40 / 0.0005 AT5G01450 327 / 7e-108 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035335 [exp] 120 / 4e-35 AT4G22250 114 / 4e-33 RING/U-box superfamily protein (.1) Lus10029993 [exp] 119 / 6e-35 AT4G03965 118 / 2e-34 RING/U-box superfamily protein (.1) Lus10015152 [exp] 115 / 7e-33 AT4G03965 123 / 1e-35 RING/U-box superfamily protein (.1) Lus10038180 [exp] 81 / 4e-18 AT3G07120 122 / 6e-33 RING/U-box superfamily protein (.1) Lus10025921 [exp] 80 / 4e-18 AT3G07120 117 / 3e-31 RING/U-box superfamily protein (.1) Lus10034030 [exp] 42 / 0.0002 AT5G19080 344 / 1e-116 RING/U-box superfamily protein (.1) Lus10043365 [exp] 41 / 0.0003 AT5G22750 1445 / 0.0 DNA/RNA helicase protein (.1) Lus10035332 [exp] 40 / 0.0007 AT2G32950 1088 / 0.0 FUSCA 1, EMBRYO DEFECTIVE 168, DEETIOLATED MUTANT 340, ARABIDOPSIS THALIANA CONSTITUTIVE PHOTOMORPHOGENIC 1, Transducin/WD40 repeat-like superfamily protein (.1) Lus10016817 [exp] 40 / 0.0007 AT2G22010 1406 / 0.0 related to KPC1 (.1.2) Lus10029990 [exp] 40 / 0.0008 AT2G32950 1088 / 0.0 FUSCA 1, EMBRYO DEFECTIVE 168, DEETIOLATED MUTANT 340, ARABIDOPSIS THALIANA CONSTITUTIVE PHOTOMORPHOGENIC 1, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.014G158900.2 pacid=42763736 polypeptide=Potri.014G158900.2.p locus=Potri.014G158900 ID=Potri.014G158900.2.v4.1 annot-version=v4.1 ATGCAACCAGGCTTGGATGAGATCACAATGACGGCGTGGAAGAATCTAAAGCAACGGCTCTCATTCAAGGGCCTGGGTAGTTGCTGCGGGAGCACAAGCT GGAGTTCCAGAAGTGCCACCCCAACCATGCCCTTTATCGATATAGAGCAAGAAGAAGAGGAAGAGCCCATCATGCAAAACCAAGCTCAAAGAGGAGGAGG AGCTGCAGCAGCAGCAGCAGCGCCAGGTGCTGGGATGAATCTGGCAATGGCATTAGCTGCTGAGCGCAATTTAGGGGATTCAAATGTCAAGACATTGATG AGTTTGATCGAAGAAACGGACGGTGTTGATTGGAGGAAGAAGAATAACAGTAATGATAAAAGTAGGAGGGACAAGGAACAGGAACAGAAGCAGGAAGAAG AGAAGGATTGGGTATGCTGCGTTTGCATGGAGAGAAATAAAGGCGCAGCTTTTATTCCATGTGGACACACCTTTTGTAGGGTTTGTTCAAGAGAAATGTG GGTTAATCGAGGGTGCTGTCCTATCTGCAACCGTTCCATTCTCGACATCCTTGATATCTTCTAG
AA sequence Show only first row Show all	>Potri.014G158900.2 pacid=42763736 polypeptide=Potri.014G158900.2.p locus=Potri.014G158900 ID=Potri.014G158900.2.v4.1 annot-version=v4.1 MQPGLDEITMTAWKNLKQRLSFKGLGSCCGSTSWSSRSATPTMPFIDIEQEEEEEPIMQNQAQRGGGAAAAAAAPGAGMNLAMALAAERNLGDSNVKTLM SLIEETDGVDWRKKNNSNDKSRRDKEQEQKQEEEKDWVCCVCMERNKGAAFIPCGHTFCRVCSREMWVNRGCCPICNRSILDILDIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G22250			RING/U-box superfamily protein...		Potri.014G158900 [exp]	0	1
AT3G06840			unknown protein		Potri.001G162100 [exp]	2.00	0.9447
AT1G28400			unknown protein		Potri.011G057500 [exp]	2.23	0.9458
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Potri.004G218500 [exp]	2.64	0.9354	MLO4.1
AT1G26560		BGLU40	beta glucosidase 40 (.1)		Potri.008G094200 [exp]	3.16	0.9267	Pt-HIUHASE.1
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Potri.016G013700 [exp]	3.60	0.9203	GDI1.2
AT3G54950		pPLAIIIbeta, PL...	patatin-related phospholipase ...		Potri.015G122700 [exp]	4.24	0.9427
AT4G12420		SKU5	Cupredoxin superfamily protein...		Potri.001G120300 [exp]	4.47	0.9421	SKU5.2
AT4G30320			CAP (Cysteine-rich secretory p...		Potri.018G096007 [exp]	5.47	0.9388
AT5G20540		ATBRXL4, BRX-LI...	BREVIS RADIX-like 4 (.1)		Potri.018G064900 [exp]	6.16	0.9155
AT3G54750			unknown protein		Potri.016G065600 [exp]	7.14	0.9157

Compare expression of checked genes

Potri.014G158900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.