Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21222 57 / 2e-11 protein kinase family protein (.1) AT2G26980 56 / 8e-11 CIPK3, SnRK3.17 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) AT1G01140 55 / 1e-10 PKS6, CIPK9, SnRK3.12 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) AT1G30270 54 / 4e-10 PKS17, ATCIPK23, SnRK3.23, LKS1, CIPK23 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) AT5G10930 52 / 2e-09 CIPK5, SnRK3.24 SNF1-RELATED PROTEIN KINASE 3.24, CBL-interacting protein kinase 5 (.1) AT4G24400 51 / 3e-09 ATCIPK8, PKS11, CIPK8, SnRK3.13 SNF1-RELATED PROTEIN KINASE 3.13, PROTEIN KINASE 11, CBL-interacting protein kinase 8 (.1.2) AT5G25110 51 / 6e-09 CIPK25, SnRK3.25 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) AT5G21326 49 / 2e-08 Ca2+regulated serine-threonine protein kinase family protein (.1) AT5G01810 47 / 1e-07 ATPK10, SnRK3.1, SIP2, PKS3, CIPK15 SNF1-RELATED PROTEIN KINASE 3.1, SOS3-INTERACTING PROTEIN 2, PROTEIN KINASE 10, CBL-interacting protein kinase 15 (.1.2.3) AT4G30960 46 / 2e-07 CIPK6, SIP3, SnRK3.14, ATCIPK6 SNF1-RELATED PROTEIN KINASE 3.14, CBL-INTERACTING PROTEIN KINASE 6, SOS3-interacting protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G222600 [exp] 65 / 6e-14 AT2G26980 752 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Potri.009G021000 [exp] 63 / 3e-13 AT2G26980 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Potri.014G104200 [exp] 57 / 3e-11 AT1G01140 688 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Potri.006G062800 [exp] 54 / 4e-10 AT1G30270 753 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.002G177900 [exp] 54 / 5e-10 AT1G01140 711 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Potri.016G133500 [exp] 51 / 5e-09 AT5G58380 593 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.013G156000 [exp] 50 / 7e-09 AT5G58380 623 / 0.0 SNF1-RELATED PROTEIN KINASE 3.8, CBL-INTERACTING PROTEIN KINASE 10, SOS3-interacting protein 1 (.1) Potri.018G119200 [exp] 50 / 8e-09 AT1G30270 749 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Potri.018G096042 [exp] 50 / 1e-08 AT5G57630 535 / 0.0 SNF1-RELATED PROTEIN KINASE 3.4, CBL-interacting protein kinase 21 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022590 [exp] 64 / 2e-13 AT2G26980 684 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Lus10021488 [exp] 62 / 8e-13 AT2G26980 591 / 0.0 SNF1-RELATED PROTEIN KINASE 3.17, CBL-interacting protein kinase 3 (.1.2.3.4.5) Lus10030210 [exp] 56 / 8e-11 AT1G01140 709 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Lus10002692 [exp] 55 / 2e-10 AT1G01140 709 / 0.0 SNF1-RELATED PROTEIN KINASE 3.12, PROTEIN KINASE 6, CBL-interacting protein kinase 9 (.1.2.3) Lus10042816 [exp] 54 / 5e-10 AT1G30270 794 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Lus10028115 [exp] 54 / 5e-10 AT1G30270 793 / 0.0 SNF1-RELATED PROTEIN KINASE 3.23, SOS2-like protein kinase 17, LOW-K+-SENSITIVE 1, CBL-interacting protein kinase 23 (.1) Lus10019411 [exp] 54 / 7e-10 AT5G35410 729 / 0.0 SNF1-RELATED PROTEIN KINASE 3.11, CBL-INTERACTING PROTEIN KINASE 24, SALT OVERLY SENSITIVE 2, Protein kinase superfamily protein (.1) Lus10032822 [exp] 53 / 1e-09 AT4G24400 738 / 0.0 SNF1-RELATED PROTEIN KINASE 3.13, PROTEIN KINASE 11, CBL-interacting protein kinase 8 (.1.2) Lus10007448 [exp] 51 / 7e-09 AT5G25110 650 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1) Lus10024448 [exp] 51 / 7e-09 AT5G25110 654 / 0.0 SNF1-RELATED PROTEIN KINASE 3.25, CBL-interacting protein kinase 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.014G161400.2 pacid=42764550 polypeptide=Potri.014G161400.2.p locus=Potri.014G161400 ID=Potri.014G161400.2.v4.1 annot-version=v4.1 ATGGTAAACCATGAGCTGATGAGAGAAGATGAAGCTCAGAGATATTGCCACCAGCTTATCAATATAGTGGATCATTGCCACAGCAAGGGTGTTTCTCACA GAGACCTCAAGGGCATCAAATCCTCATCTATAAAGCCACGAGAAAGAAGGGACCGAGAGAGAAAGCCATTGAAACTTCTCCATCCACTGGTGGAAGTAGG TGATTTGGGACTTGTCAGGTTTCTCTAA
AA sequence Show only first row Show all	>Potri.014G161400.2 pacid=42764550 polypeptide=Potri.014G161400.2.p locus=Potri.014G161400 ID=Potri.014G161400.2.v4.1 annot-version=v4.1 MVNHELMREDEAQRYCHQLINIVDHCHSKGVSHRDLKGIKSSSIKPRERRDRERKPLKLLHPLVEVGDLGLVRFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G21222			protein kinase family protein ...		Potri.014G161400 [exp]	0	1
AT4G28880		CKL3	casein kinase I-like 3 (.1)		Potri.018G041000 [exp]	6.32	0.8380
AT3G44160			Outer membrane OMP85 family pr...		Potri.009G017100 [exp]	6.70	0.8098
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.004G127200 [exp]	7.74	0.8154
AT5G57700			BNR/Asp-box repeat family prot...		Potri.006G175161 [exp]	11.61	0.8346
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Potri.011G154600 [exp]	15.19	0.7765
AT5G38260			Protein kinase superfamily pro...		Potri.007G125200 [exp]	15.36	0.8198
AT3G15820		ROD1	REDUCED OLEATE DESATURATION 1,...		Potri.003G032200 [exp]	18.54	0.7158
					Potri.010G181700 [exp]	19.59	0.8150
					Potri.010G139550 [exp]	20.00	0.7918
AT1G49820		MTK1, ATMTK	5-methylthioribose kinase 1, S...		Potri.001G299700 [exp]	20.97	0.7524

Compare expression of checked genes

Potri.014G161400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.