Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47530 157 / 2e-46 Auxin-responsive family protein (.1) AT4G17280 154 / 2e-45 Auxin-responsive family protein (.1) AT5G48750 137 / 2e-40 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1) AT3G59070 137 / 1e-38 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1) AT5G35735 123 / 1e-33 Auxin-responsive family protein (.1) AT4G12980 101 / 2e-25 Auxin-responsive family protein (.1) AT3G25290 96 / 1e-23 Auxin-responsive family protein (.1.2) AT3G07390 92 / 1e-22 AIR12 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) AT2G04850 72 / 8e-15 Auxin-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G156600 [exp] 176 / 1e-53 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1) Potri.016G010900 [exp] 175 / 1e-53 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1) Potri.006G015000 [exp] 170 / 1e-51 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1) Potri.010G156200 [exp] 161 / 2e-48 AT5G47530 472 / 1e-166 Auxin-responsive family protein (.1) Potri.019G095800 [exp] 157 / 1e-46 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1) Potri.019G096300 [exp] 156 / 3e-46 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1) Potri.013G118300 [exp] 154 / 1e-45 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1) Potri.019G096400 [exp] 154 / 4e-45 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1) Potri.001G031600 [exp] 152 / 1e-44 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017564 [exp] 157 / 1e-46 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1) Lus10010498 [exp] 155 / 1e-45 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1) Lus10002274 [exp] 150 / 7e-44 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1) Lus10012350 [exp] 147 / 8e-43 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1) Lus10001734 [exp] 147 / 9e-43 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1) Lus10038224 [exp] 91 / 2e-22 AT3G07390 182 / 7e-57 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) Lus10025879 [exp] 89 / 1e-21 AT3G07390 181 / 3e-56 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) Lus10001162 [exp] 72 / 9e-15 AT2G04850 563 / 0.0 Auxin-responsive family protein (.1) Lus10001736 [exp] 70 / 3e-14 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1) Lus10025878 [exp] 57 / 6e-11 AT3G25290 88 / 8e-22 Auxin-responsive family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04526 [poplar] [flax] DUF568 Protein of unknown function (DUF568)
Representative CDS sequence Show only first row Show all	>Potri.014G161900.1 pacid=42763458 polypeptide=Potri.014G161900.1.p locus=Potri.014G161900 ID=Potri.014G161900.1.v4.1 annot-version=v4.1 ATGGCTATTACCTCAACACCTGCATTGTTTATTAGCATACTTCTCTCCTTAGTCCTCATTTCTTCTGCTCAATCATGCTCAAAATACACCTTTCCAGGTA ATCAAGCATTCAATTCTTGCATCGACCTCCCTTTCCTACAGGCCAATCTCCATTGGAACTACATTCCATCCACCAGAACTGTTCACATAGCATATAGAGC CAACCAAACTTCTACAGGATGGATTGCATGGGCAATCAATCCAAATGGTGCAGGCATGGTTGGATCACAAGCTCTTGTTGCCTTTCATAATTCTAATGGG AGCTTGACTGCCTATCCAACCCCAATAACTAGTTATACCACATCAATGCGACCAGGAGCTCTCAGCTTTCACGTGTCAAACATCTCTGCAACATATGCAG ATAATCAGATGAGTATCTTCGCTGTGCTGGGCCCTCTACAAAATGGAACTGCTGTTAATCATGTCTGGCAAGCTGGGAATTCAGTTATAAATGACATCCC TTCGAGTCATGCTACAACAGGACCAAATATTCAATCAATGGGGACATTAAATTTTTTTTCAGGATAG
AA sequence Show only first row Show all	>Potri.014G161900.1 pacid=42763458 polypeptide=Potri.014G161900.1.p locus=Potri.014G161900 ID=Potri.014G161900.1.v4.1 annot-version=v4.1 MAITSTPALFISILLSLVLISSAQSCSKYTFPGNQAFNSCIDLPFLQANLHWNYIPSTRTVHIAYRANQTSTGWIAWAINPNGAGMVGSQALVAFHNSNG SLTAYPTPITSYTTSMRPGALSFHVSNISATYADNQMSIFAVLGPLQNGTAVNHVWQAGNSVINDIPSSHATTGPNIQSMGTLNFFSG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G47530			Auxin-responsive family protei...		Potri.014G161900 [exp]	0	1
AT5G63380			AMP-dependent synthetase and l...		Potri.012G095000 [exp]	11.87	0.8133
AT4G31550	WRKY	ATWRKY11, WRKY1...	WRKY DNA-binding protein 11 (....		Potri.001G121300 [exp]	12.40	0.8134
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Potri.001G075000 [exp]	12.96	0.7701
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.001G109100 [exp]	13.45	0.8458	Pt-CYP87.1
AT4G23980	ARF	ARF9	auxin response factor 9 (.1.2)		Potri.001G088600 [exp]	22.80	0.8002
AT4G25850		ORP4B	OSBP(oxysterol binding protein...		Potri.018G143600 [exp]	31.08	0.7843
AT1G08650		ATPPCK1, PPCK1	phosphoenolpyruvate carboxylas...		Potri.008G166500 [exp]	33.31	0.7288
AT5G06510	CCAAT	NF-YA10	"nuclear factor Y, subunit A10...		Potri.006G201900 [exp]	34.33	0.7903
AT5G51160			Ankyrin repeat family protein ...		Potri.015G111300 [exp]	55.64	0.7716
AT1G25500			Plasma-membrane choline transp...		Potri.008G118200 [exp]	64.34	0.7294

Compare expression of checked genes

Potri.014G161900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.