Potri.014G163301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55390 57 / 9e-11 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2)
AT5G48090 56 / 3e-10 ELP1 EDM2-like protein1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G359900 68 / 1e-14 AT5G55390 915 / 0.0 ENHANCED DOWNY MILDEW 2 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001729 59 / 3e-11 AT5G55390 622 / 0.0 ENHANCED DOWNY MILDEW 2 (.1.2)
Lus10002268 52 / 3e-09 AT5G48090 148 / 7e-41 EDM2-like protein1 (.1.2)
Lus10023353 49 / 8e-08 AT5G55390 890 / 0.0 ENHANCED DOWNY MILDEW 2 (.1.2)
PFAM info
Representative CDS sequence
>Potri.014G163301.1 pacid=42764496 polypeptide=Potri.014G163301.1.p locus=Potri.014G163301 ID=Potri.014G163301.1.v4.1 annot-version=v4.1
ATGAACCTTGGAGGAATTGCTAGACAGTTCACAGCTGGTACGAAAAGATCATTTTATCTGTCTGGATCAGCTGTTGCGAATGGCAAGCAGATAGAAGATT
GGACTGTGAACACACCTCCGATATATATTTGGAGTCGTGCTGATTGGACTGCCTGGCGCATTCCAATAGCACGAGAGCATGGTCACGTATCTAAAGAACA
AGATGATTATTTATCCGGAGATGAATATTATGTGATGGTTTCCCTAATCCACTTGGCGTTCCTCGGGGTGATTGCAGACGTGTAG
AA sequence
>Potri.014G163301.1 pacid=42764496 polypeptide=Potri.014G163301.1.p locus=Potri.014G163301 ID=Potri.014G163301.1.v4.1 annot-version=v4.1
MNLGGIARQFTAGTKRSFYLSGSAVANGKQIEDWTVNTPPIYIWSRADWTAWRIPIAREHGHVSKEQDDYLSGDEYYVMVSLIHLAFLGVIADV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.014G163301 0 1
Potri.010G224650 2.00 0.9361
AT5G53820 Late embryogenesis abundant pr... Potri.004G107700 3.60 0.7374
AT2G35040 AICARFT/IMPCHase bienzyme fami... Potri.008G128301 6.00 0.7028
AT2G18950 ATHPT, VTE2, TP... VITAMIN E 2, homogentisate phy... Potri.018G022000 7.34 0.7983
AT2G26430 ATRCY1, RCY1 arginine-rich cyclin 1 (.1.2.3... Potri.010G218001 7.48 0.7254
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.012G072500 7.93 0.6513 Pt-MYB.54,MYB198
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024933 8.66 0.7229
AT4G30390 unknown protein Potri.019G051850 8.71 0.6849
Potri.004G127001 9.59 0.6114
AT3G03760 AS2 LBD20 LOB domain-containing protein ... Potri.013G064501 12.40 0.6261

Potri.014G163301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.