Potri.014G163866 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14103 79 / 3e-16 F-box/RNI-like superfamily protein (.1.2)
AT2G42720 71 / 2e-13 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1)
AT1G06630 70 / 4e-13 F-box/RNI-like superfamily protein (.1.2.3)
AT5G18780 69 / 9e-13 F-box/RNI-like superfamily protein (.1.2)
AT1G58310 69 / 9e-13 F-box/RNI-like superfamily protein (.1)
AT3G58920 68 / 1e-12 F-box/RNI-like superfamily protein (.1)
AT3G59200 67 / 2e-12 F-box/RNI-like superfamily protein (.1)
AT1G22000 67 / 3e-12 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT4G00315 67 / 4e-12 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT1G69630 67 / 4e-12 F-box/RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G121400 360 / 5e-123 AT1G16930 149 / 9e-40 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.011G121500 322 / 7e-108 AT4G14103 142 / 6e-38 F-box/RNI-like superfamily protein (.1.2)
Potri.010G134200 79 / 2e-16 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1)
Potri.011G024600 72 / 8e-14 AT4G26350 95 / 9e-21 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.002G132400 64 / 4e-11 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1)
Potri.011G024300 63 / 6e-11 AT3G49030 116 / 3e-28 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Potri.014G039700 59 / 1e-09 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1)
Potri.017G107600 58 / 3e-09 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1)
Potri.011G024200 57 / 8e-09 AT4G26340 105 / 1e-24 F-box/RNI-like/FBD-like domains-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034415 72 / 4e-14 AT1G13570 358 / 1e-123 F-box/RNI-like superfamily protein (.1)
Lus10034414 72 / 1e-13 AT1G13570 475 / 5e-167 F-box/RNI-like superfamily protein (.1)
Lus10019144 67 / 3e-12 AT1G13570 482 / 6e-170 F-box/RNI-like superfamily protein (.1)
Lus10004851 58 / 3e-09 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1)
Lus10034418 57 / 6e-09 AT1G13570 148 / 1e-38 F-box/RNI-like superfamily protein (.1)
Lus10013071 57 / 8e-09 AT1G65440 275 / 7e-79 global transcription factor group B1 (.1.2.3)
Lus10006342 57 / 9e-09 AT5G51920 432 / 4e-144 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Lus10029077 56 / 1e-08 AT1G13570 82 / 1e-16 F-box/RNI-like superfamily protein (.1)
Lus10004852 56 / 1e-08 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1)
Lus10018509 55 / 3e-08 AT4G03220 401 / 1e-135 Protein with RNI-like/FBD-like domains (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Potri.014G163866.1 pacid=42762971 polypeptide=Potri.014G163866.1.p locus=Potri.014G163866 ID=Potri.014G163866.1.v4.1 annot-version=v4.1
ATGGCAAAAGACAATAGACGAAAACGTTACAAGAAAGCGAATAAAGATATGATTTGTAGATTGCCTAATGAGATTCTTGGTCATGTACTCTCGTTTCTTC
CTATAAAAGATGCTGTGCGAACCAGCATTTTGTCCAAAAGTTGGAGAGAACTCTGGACATCACTTGCCAATTTTAATTTTGATGATCACATTCGGTGGCA
ACTATCAGCAGAAAGAGAGACCACCTTTGGGGATTTCATGGATAGGTTTTGTTATCTTCATAACTCTCCTGAAAACTCTATTGCAAAATTTCATCTCAGA
GACAATCTTGAGGAGCTTATACTATACACGTCTGATCATGTTCTGTTGCCTCGGAGAATTTTTAGTTGTGAGAAATTAGTGGCTTTGGACCTTAGTTATC
GAATTGATATTGATCTTCTTGGGGTTGGTGTACGCTTTCCATGTCTCAAGGTCCTTCATCTTCAAGACCTCCTGATGCTTGATGATCATGCTTCCATAGA
GAAACTATTAGCAGGTTCCCCGGTCCTTGAAGCACTGAAATTTGAACATGAAGATTGTGAATCCAGGAACGCCTTACGTATATGCTCAAGCTCACTGGAA
CGCTTGATCATAAGATTTACATTTATTGCTTATTACGTGAAGGATCCTGGTTGTAGAGCACTAAAAGTGGTGTTTGCCTGGGCGGTGCAACCACCGCCTC
TGTACTCACTGGTAGAGGCAGCTCTCCGTGTTGCTTATGAACATGTCTTCACCATACAAGTAGATGATTATATTGACATGACAGTTCAGTTTTTGAGACC
GATCATGCCTATTGTCAAGAACTTACAATTGTGTGATTCTACTATGAGACGCTATCAGACACAGTTCATAAGAAGTTGCCTGGCTTTGACAATCTTCCTG
ATTTCAGAATTTGACTCGTTTGGAGATTGA
AA sequence
>Potri.014G163866.1 pacid=42762971 polypeptide=Potri.014G163866.1.p locus=Potri.014G163866 ID=Potri.014G163866.1.v4.1 annot-version=v4.1
MAKDNRRKRYKKANKDMICRLPNEILGHVLSFLPIKDAVRTSILSKSWRELWTSLANFNFDDHIRWQLSAERETTFGDFMDRFCYLHNSPENSIAKFHLR
DNLEELILYTSDHVLLPRRIFSCEKLVALDLSYRIDIDLLGVGVRFPCLKVLHLQDLLMLDDHASIEKLLAGSPVLEALKFEHEDCESRNALRICSSSLE
RLIIRFTFIAYYVKDPGCRALKVVFAWAVQPPPLYSLVEAALRVAYEHVFTIQVDDYIDMTVQFLRPIMPIVKNLQLCDSTMRRYQTQFIRSCLALTIFL
ISEFDSFGD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14103 F-box/RNI-like superfamily pro... Potri.014G163866 0 1
AT1G06137 unknown protein Potri.001G380300 12.44 0.6677
AT1G32583 unknown protein Potri.010G145501 24.53 0.8553
AT1G63060 unknown protein Potri.003G160700 25.69 0.6288
AT4G30880 Bifunctional inhibitor/lipid-t... Potri.009G048900 35.91 0.8553
AT2G05920 Subtilase family protein (.1) Potri.001G113533 41.47 0.8553
AT3G04280 ARR22 response regulator 22 (.1.2.3) Potri.003G177300 42.49 0.8553
Potri.014G045150 45.43 0.8553
Potri.019G036825 46.36 0.8553
AT3G58610 ketol-acid reductoisomerase (.... Potri.019G089366 47.28 0.8553
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.013G118200 53.06 0.8493

Potri.014G163866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.