Potri.014G164600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35740 179 / 6e-60 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G04910 136 / 6e-43 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT3G13560 107 / 2e-28 O-Glycosyl hydrolases family 17 protein (.1.2.3)
AT1G29380 104 / 4e-28 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G29360 103 / 9e-27 O-Glycosyl hydrolases family 17 protein (.1.2)
AT1G11820 102 / 1e-26 O-Glycosyl hydrolases family 17 protein (.1.2)
AT4G13600 96 / 2e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G79480 97 / 4e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT2G05790 97 / 8e-25 O-Glycosyl hydrolases family 17 protein (.1)
AT5G67460 96 / 1e-24 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G016800 177 / 5e-59 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G078500 106 / 8e-29 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G059600 104 / 1e-28 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.003G218500 105 / 1e-27 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.011G006100 105 / 2e-27 AT1G11820 805 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.001G006500 104 / 3e-27 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Potri.001G353400 102 / 3e-27 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.017G055700 97 / 2e-26 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.004G010500 101 / 4e-26 AT1G11820 794 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012324 187 / 9e-63 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001167 172 / 5e-57 AT5G35740 150 / 3e-48 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10039059 152 / 1e-48 AT5G35740 157 / 3e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10038801 143 / 3e-45 AT5G35740 146 / 1e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10001740 124 / 4e-38 AT5G35740 111 / 2e-33 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10004546 108 / 9e-30 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10004600 108 / 2e-29 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10007342 102 / 2e-27 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10020765 101 / 2e-27 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10015259 101 / 3e-27 AT1G29380 143 / 4e-41 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.014G164600.2 pacid=42763424 polypeptide=Potri.014G164600.2.p locus=Potri.014G164600 ID=Potri.014G164600.2.v4.1 annot-version=v4.1
ATGCCAATCCTTTGGAAAAGGACAATGCTAGCCCTTCTTATCCTGTCCATAGCTCCTAGGAAATCAGATGGGGAGTTAGAGCAATGGTGCATAGCAGATG
AGCAGACCCCAGATGATGAGTTGCAGATAGCATTGGACTGGGCTTGTGGGAAAGGTGGTGCAGACTGCAGTAAGATTCAAGTGAACCAGCCTTGCTATTT
GCCAAATACTGTGAGAGACCATGCTTCCTATGCCTTCAACAACTACTTCCAGAAGTTCAAGCACAAAGGTGGATCTTGCTACTTCAAAGGAGCTGCTATC
ATTACAGAACTTGACCCCAGTCATAGCTCTTGCCAGTACGAGTTCCATCCCTGA
AA sequence
>Potri.014G164600.2 pacid=42763424 polypeptide=Potri.014G164600.2.p locus=Potri.014G164600 ID=Potri.014G164600.2.v4.1 annot-version=v4.1
MPILWKRTMLALLILSIAPRKSDGELEQWCIADEQTPDDELQIALDWACGKGGADCSKIQVNQPCYLPNTVRDHASYAFNNYFQKFKHKGGSCYFKGAAI
ITELDPSHSSCQYEFHP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G35740 Carbohydrate-binding X8 domain... Potri.014G164600 0 1
AT2G34770 ATFAH1, FAH1 ARABIDOPSIS FATTY ACID HYDROXY... Potri.001G463800 3.16 0.8272 FAH1.2
AT4G23820 Pectin lyase-like superfamily ... Potri.003G139100 4.79 0.8371
AT1G24620 EF hand calcium-binding protei... Potri.010G107100 5.47 0.8124
AT5G39240 unknown protein Potri.017G093000 6.00 0.8069
AT5G13100 unknown protein Potri.003G168300 9.48 0.7566
AT1G63850 BTB/POZ domain-containing prot... Potri.001G100900 15.87 0.7811
AT1G66150 TMK1 transmembrane kinase 1 (.1) Potri.004G084000 16.73 0.7781
AT4G18570 Tetratricopeptide repeat (TPR)... Potri.004G054900 24.67 0.7412
AT4G30320 CAP (Cysteine-rich secretory p... Potri.006G171300 24.81 0.7570
AT5G46290 KAS1, KAS I, KA... KETOACYL-ACP SYNTHASE 1, 3-ket... Potri.003G142000 25.09 0.8050

Potri.014G164600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.