Potri.014G165300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07760 228 / 5e-79 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001743 167 / 6e-55 AT3G07760 154 / 7e-50 Sterile alpha motif (SAM) domain-containing protein (.1), Sterile alpha motif (SAM) domain-containing protein (.2)
Lus10001171 142 / 9e-42 AT2G05250 308 / 2e-98 DNAJ heat shock N-terminal domain-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0003 SAM PF07647 SAM_2 SAM domain (Sterile alpha motif)
Representative CDS sequence
>Potri.014G165300.6 pacid=42763511 polypeptide=Potri.014G165300.6.p locus=Potri.014G165300 ID=Potri.014G165300.6.v4.1 annot-version=v4.1
ATGAGCAAAGAAAGGCCTCCTGAGCCTCTCGATTTCTTCATTTGGACTGTTGAGGATGTTGGTTTGTGGTTAGAAGAAATAAATCTTGGCAGCTACCGCC
AAATTTTTAAAGATAATGGTGTGAACGGAGAATATCTGGAAGGCATGTCCATGTTCACAACTGAACAGATTTTACGGTTTATAAGGCGGTGCCACATGAA
GTGGGGAGACTTCATCACACTATGTAAGGAGCTCAGACGAATAAAAGTGGCTTGCCTAAAAGGAGAGCAAAAGGTTCGCCGGCCATGGTGGGTTCCGTCC
TGCCTCTCCGCAATCTTTGTCAAGGTTGCAAAGCACAACAGACAGTCACGAGTTGTTTCCTTGAAGCTGGAACCATGA
AA sequence
>Potri.014G165300.6 pacid=42763511 polypeptide=Potri.014G165300.6.p locus=Potri.014G165300 ID=Potri.014G165300.6.v4.1 annot-version=v4.1
MSKERPPEPLDFFIWTVEDVGLWLEEINLGSYRQIFKDNGVNGEYLEGMSMFTTEQILRFIRRCHMKWGDFITLCKELRRIKVACLKGEQKVRRPWWVPS
CLSAIFVKVAKHNRQSRVVSLKLEP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07760 Sterile alpha motif (SAM) doma... Potri.014G165300 0 1
AT3G55520 FKBP-like peptidyl-prolyl cis-... Potri.008G057900 3.46 0.6234
AT5G13660 unknown protein Potri.010G209300 4.69 0.6582
AT2G20990 SYT1, NTMC2TYPE... SYNAPTOTAGMIN 1, ARABIDOPSIS T... Potri.004G174600 5.74 0.6697
AT3G26935 DHHC-type zinc finger family p... Potri.012G103300 6.00 0.6524
AT5G38630 ACYB-1 cytochrome B561-1 (.1) Potri.004G103800 9.53 0.5739
AT5G54840 ATSGP1 Ras-related small GTP-binding ... Potri.001G420700 37.94 0.5500
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Potri.010G070750 38.45 0.5695
AT2G30360 PKS5, CIPK11, S... SNF1-RELATED PROTEIN KINASE 3.... Potri.013G155600 41.71 0.5428
AT1G16180 Serinc-domain containing serin... Potri.003G186500 45.71 0.5519
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.001G381300 46.73 0.5199 Pt-TDY1.2

Potri.014G165300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.