Potri.014G168232 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19640 114 / 1e-30 JMT jasmonic acid carboxyl methyltransferase (.1)
AT3G11480 108 / 2e-28 BSMT1, ATBSMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G04370 100 / 1e-25 NAMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
AT5G66430 94 / 2e-23 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G38020 92 / 2e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT5G04380 92 / 2e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT4G36470 91 / 6e-22 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT2G14060 76 / 7e-17 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT3G21950 76 / 1e-16 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G15125 72 / 3e-15 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G230100 124 / 1e-34 AT1G19640 389 / 1e-134 jasmonic acid carboxyl methyltransferase (.1)
Potri.007G021300 123 / 4e-34 AT3G11480 318 / 1e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022002 120 / 4e-33 AT3G11480 309 / 3e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022400 119 / 8e-33 AT3G11480 311 / 4e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022402 115 / 3e-31 AT3G11480 261 / 1e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.019G022000 109 / 4e-29 AT3G11480 300 / 7e-100 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.005G045900 105 / 2e-27 AT1G19640 271 / 3e-88 jasmonic acid carboxyl methyltransferase (.1)
Potri.019G022200 92 / 1e-22 AT5G04370 227 / 1e-71 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Potri.010G104800 85 / 6e-20 AT1G68040 328 / 4e-111 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024271 121 / 2e-33 AT1G19640 315 / 2e-105 jasmonic acid carboxyl methyltransferase (.1)
Lus10025993 107 / 6e-28 AT1G19640 288 / 1e-93 jasmonic acid carboxyl methyltransferase (.1)
Lus10041380 99 / 4e-25 AT4G36470 278 / 4e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036548 92 / 3e-22 AT5G66430 250 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036550 89 / 3e-21 AT3G11480 249 / 8e-80 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10036547 87 / 1e-20 AT5G66430 243 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10024671 83 / 6e-19 AT5G66430 280 / 2e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10041776 78 / 2e-17 AT4G36470 421 / 3e-147 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10041781 56 / 2e-10 AT5G66430 54 / 4e-09 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10043177 58 / 3e-10 AT5G55250 532 / 0.0 IAA carboxylmethyltransferase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence
>Potri.014G168232.1 pacid=42764690 polypeptide=Potri.014G168232.1.p locus=Potri.014G168232 ID=Potri.014G168232.1.v4.1 annot-version=v4.1
ATGATTCCTGGAGGTTGTATGGTGCTTACCATCTATGGAAGAGATGAGAACAATGATTCTTCTGTAAAACACAGCCCCACCATCTGGGAATTTTTTGGGA
TGATGCTGAATGACATGGTATTAGAGGGATTGATCGAAGAATCGAAGCTGGACTCCTTCAATATTCCATTCTATGGAGCGTTAGCTGAAGAAGTAAGAGA
TGTGATTCAAGCAGAAGGATCGTTTACCATCAAACGGCTTGAATCCTTCCATGTAAGTTGGGATGCAAGCATCGACGATCGTTACAGAGATACGATGGAT
AAGTATACGAAAGGCAAGTTCGTAGCAAAGAGAATGAGAGCTATTATGGAGTCCATACTGGCAAGGCATTTTGGAGACGAAATCGTTGATGTTTTGTTCC
AAAGATTTTCGATCAAGATAGGAGAGTACATGGAAACAGTCAATGGTGAATACAACAATCATGTAGTTTCCATGGCTAAGGCATGA
AA sequence
>Potri.014G168232.1 pacid=42764690 polypeptide=Potri.014G168232.1.p locus=Potri.014G168232 ID=Potri.014G168232.1.v4.1 annot-version=v4.1
MIPGGCMVLTIYGRDENNDSSVKHSPTIWEFFGMMLNDMVLEGLIEESKLDSFNIPFYGALAEEVRDVIQAEGSFTIKRLESFHVSWDASIDDRYRDTMD
KYTKGKFVAKRMRAIMESILARHFGDEIVDVLFQRFSIKIGEYMETVNGEYNNHVVSMAKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G19640 JMT jasmonic acid carboxyl methylt... Potri.014G168232 0 1
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Potri.018G029100 3.00 0.8462
AT4G27190 NB-ARC domain-containing disea... Potri.019G036875 4.00 0.8622
AT4G22790 MATE efflux family protein (.1... Potri.003G116700 7.48 0.8380
Potri.006G077775 8.30 0.8759
AT2G33770 ATUBC24, UBC24,... UBIQUITIN-CONJUGATING ENZYME 2... Potri.011G052600 10.72 0.8429
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G022400 20.09 0.8449
AT1G61310 LRR and NB-ARC domains-contain... Potri.001G427670 21.35 0.8375
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Potri.006G115000 21.84 0.8364
AT5G06510 CCAAT NF-YA10 "nuclear factor Y, subunit A10... Potri.006G201900 23.62 0.8284
AT4G23980 ARF ARF9 auxin response factor 9 (.1.2) Potri.001G088600 24.39 0.8287

Potri.014G168232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.