Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04240 181 / 4e-59 XERICO RING/U-box superfamily protein (.1.2) AT1G67856 83 / 7e-21 RING/U-box superfamily protein (.1) AT3G61460 74 / 5e-17 BRH1 brassinosteroid-responsive RING-H2 (.1) AT2G01150 70 / 8e-16 RHA2B RING-H2 finger protein 2B (.1) AT4G11360 69 / 3e-15 RHA1B RING-H2 finger A1B (.1) AT1G15100 65 / 8e-14 RHA2A RING-H2 finger A2A (.1) AT4G00305 64 / 1e-13 RING/U-box superfamily protein (.1) AT4G11370 64 / 3e-13 RHA1A RING-H2 finger A1A (.1) AT1G63840 62 / 1e-12 RING/U-box superfamily protein (.1) AT5G41400 61 / 6e-12 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G047100 [exp] 97 / 2e-26 AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1) Potri.008G185800 [exp] 83 / 5e-21 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1) Potri.003G130900 [exp] 77 / 2e-18 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.014G087700 [exp] 73 / 1e-16 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1) Potri.007G086300 [exp] 71 / 4e-16 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1) Potri.001G101000 [exp] 69 / 4e-15 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.005G081300 [exp] 68 / 8e-15 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1) Potri.002G161900 [exp] 67 / 2e-14 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1) Potri.005G081200 [exp] 66 / 3e-14 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011416 [exp] 87 / 1e-22 AT1G67856 124 / 1e-37 RING/U-box superfamily protein (.1) Lus10017510 [exp] 72 / 4e-16 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10032290 [exp] 70 / 1e-15 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10036378 [exp] 71 / 2e-15 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1) Lus10028773 [exp] 69 / 4e-15 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10024657 [exp] 68 / 9e-15 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10019150 [exp] 58 / 4e-11 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2) Lus10007936 [exp] 57 / 6e-11 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1) Lus10013475 [exp] 57 / 7e-11 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1) Lus10008283 [exp] 56 / 3e-10 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.014G170400.6 pacid=42763952 polypeptide=Potri.014G170400.6.p locus=Potri.014G170400 ID=Potri.014G170400.6.v4.1 annot-version=v4.1 ATGGGTCTATCAAGTCTGCCAGCTCCATCTGAAGGAGTATTATGTGTGCTTTTAGTAAACACTGCCTTGTCAATTTCCATTGTCAAAGGAATAGTCCGTT CAATCCTTCATATTGTTGGCATCCGTTTGTCACCATCTGCATCACTCCCATCGTCAGATAATGCTGAAGACACCAGAGAGTCGCTTGAATTTCGTTTAAG TCCCCCAGAGAATTACATTGAGGAGTTCCGAAGCAGGATGCCATCAATCCGATTCAACACGGTGTGCAGCTGTGAACAGCCTGAACATGACTGCTCGGTT TGCTTGACCCAATTTGAGCCAGAATCGGAGATAAATAGCCTGTCATGTGGCCATATCTTTCATAAAATGTGCTTGGAGAAGTGGTTGGACTATTGGAACA TTACATGCCCTCTTTGCAGGACTCCTTTGCTGCCTGAAGAGGATGCATCTTGCTTTTGGTGA
AA sequence Show only first row Show all	>Potri.014G170400.6 pacid=42763952 polypeptide=Potri.014G170400.6.p locus=Potri.014G170400 ID=Potri.014G170400.6.v4.1 annot-version=v4.1 MGLSSLPAPSEGVLCVLLVNTALSISIVKGIVRSILHIVGIRLSPSASLPSSDNAEDTRESLEFRLSPPENYIEEFRSRMPSIRFNTVCSCEQPEHDCSV CLTQFEPESEINSLSCGHIFHKMCLEKWLDYWNITCPLCRTPLLPEEDASCFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G04240		XERICO	RING/U-box superfamily protein...		Potri.014G170400 [exp]	0	1
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.006G236300 [exp]	2.82	0.9290
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Potri.001G245200 [exp]	6.70	0.8626
AT3G62550			Adenine nucleotide alpha hydro...		Potri.002G196700 [exp]	6.92	0.8880
AT5G47560		ATTDT, ATSDAT	tonoplast dicarboxylate transp...		Potri.006G013900 [exp]	10.81	0.8415
AT3G60530	GATA	GATA4	GATA transcription factor 4 (....		Potri.002G142800 [exp]	10.95	0.8529
AT5G28010			Polyketide cyclase/dehydrase a...		Potri.004G051500 [exp]	11.40	0.8084
AT2G30600			BTB/POZ domain-containing prot...		Potri.005G251300 [exp]	11.53	0.8527
					Potri.010G134450 [exp]	17.49	0.8467
AT1G07430		HAI2	highly ABA-induced PP2C gene 2...		Potri.008G059200 [exp]	20.73	0.7749
AT2G26695			Ran BP2/NZF zinc finger-like s...		Potri.018G066900 [exp]	21.07	0.8426

Compare expression of checked genes

Potri.014G170400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.