Plant FIBer expression Database

Potri.014G176225 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09660 64 / 1e-12 unknown protein
AT1G19260 63 / 4e-12 TTF-type zinc finger protein with HAT dimerisation domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.014G176225.1 pacid=42762449 polypeptide=Potri.014G176225.1.p locus=Potri.014G176225 ID=Potri.014G176225.1.v4.1 annot-version=v4.1
ATGTTTTCATTCTTTAAACCAAACGAACAAGCATCAACCAGTAAAGGACATTCTCCATCCAATGTTGATGTCTCAAATCGTAGTGAACAACCCCCTTTCA
GATCTCAAAGAGTTGAAATTGATGTTAATACTCTTGAACGAGATCCTGAGTTACGAATTCCAATGTGGAAACATCCTATTAATCTACAAGATGAAATTAG
AAGAGCTTATATCAAAATGGGTCCATATCAACCTAAGTTAGCAGAGTATCCAAGGACCGAATCAGGGAGACAGTATCGTCGATTTCAATACACTTGGTTT
GATCAATTTCCTCGGCTAAAGTACTCTCCATCAAAGGATGCAGTATTTTGTTTTCCATGCTTTATCTTTGAAAAAAAAGTGCCCGTCATCTCACATTCAC
CACCGAAGGCTTTAGAAGTTGGAAGAGGGTTAATGATGGGGTTAGATGTGCACTTTTGA
AA sequence
>Potri.014G176225.1 pacid=42762449 polypeptide=Potri.014G176225.1.p locus=Potri.014G176225 ID=Potri.014G176225.1.v4.1 annot-version=v4.1
MFSFFKPNEQASTSKGHSPSNVDVSNRSEQPPFRSQRVEIDVNTLERDPELRIPMWKHPINLQDEIRRAYIKMGPYQPKLAEYPRTESGRQYRRFQYTWF
DQFPRLKYSPSKDAVFCFPCFIFEKKVPVISHSPPKALEVGRGLMMGLDVHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G09660 unknown protein Potri.014G176225
[exp]
0 1
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Potri.002G113600
[exp]
1.73 0.9664
AT4G29990 Leucine-rich repeat transmembr... Potri.019G094200
[exp]
2.00 0.9648
Potri.018G011950
[exp]
3.00 0.9594
AT1G03670 ankyrin repeat family protein ... Potri.018G077766
[exp]
7.74 0.9501
AT3G46970 ATPHS2, PHS2 Arabidopsis thaliana alpha-glu... Potri.009G041800
[exp]
8.00 0.9406
AT1G76520 Auxin efflux carrier family pr... Potri.001G456300
[exp]
9.48 0.9373
AT4G27290 S-locus lectin protein kinase ... Potri.011G128600
[exp]
9.53 0.9439
AT3G10130 SOUL heme-binding family prote... Potri.016G098500
[exp]
10.72 0.9469
AT5G35170 adenylate kinase family protei... Potri.006G189201
[exp]
12.24 0.9108
AT4G39710 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex... Potri.007G087401
[exp]
14.17 0.8836

Potri.014G176225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.