Potri.014G178200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48890 60 / 1e-11 C2H2ZnF LATE LATE FLOWERING, C2H2-like zinc finger protein (.1)
AT5G14010 51 / 3e-08 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
AT1G80730 51 / 7e-08 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
AT1G66140 50 / 9e-08 C2H2ZnF ZFP4 zinc finger protein 4 (.1)
AT5G57520 49 / 9e-08 C2H2ZnF ATZFP2, ZFP2 zinc finger protein 2 (.1)
AT1G24625 50 / 1e-07 C2H2ZnF ZFP7 zinc finger protein 7 (.1)
AT5G01860 48 / 5e-07 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT5G10970 48 / 7e-07 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT5G25160 47 / 2e-06 C2H2ZnF ZFP3 zinc finger protein 3 (.1)
AT1G68480 44 / 2e-05 C2H2ZnF JAG JAGGED, C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G238700 209 / 1e-69 AT5G48890 71 / 1e-15 LATE FLOWERING, C2H2-like zinc finger protein (.1)
Potri.001G047500 57 / 7e-10 AT5G10970 143 / 5e-41 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.003G180600 56 / 2e-09 AT5G10970 144 / 1e-41 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.006G261700 54 / 7e-09 AT5G10970 166 / 4e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.001G324600 53 / 7e-09 AT5G14010 75 / 5e-17 KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.018G021400 54 / 8e-09 AT5G10970 165 / 8e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.001G298700 51 / 3e-08 AT1G24625 86 / 1e-20 zinc finger protein 7 (.1)
Potri.008G138000 52 / 4e-08 AT1G66140 155 / 2e-46 zinc finger protein 4 (.1)
Potri.010G102700 52 / 4e-08 AT1G66140 157 / 4e-47 zinc finger protein 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022816 96 / 7e-25 AT5G14010 65 / 1e-13 KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10011884 94 / 3e-24 AT5G14010 67 / 5e-14 KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10014350 53 / 1e-08 AT1G80730 110 / 1e-29 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
Lus10013243 53 / 2e-08 AT1G66140 125 / 3e-34 zinc finger protein 4 (.1)
Lus10030764 53 / 2e-08 AT1G66140 124 / 1e-33 zinc finger protein 4 (.1)
Lus10025471 51 / 3e-08 AT5G57520 92 / 3e-24 zinc finger protein 2 (.1)
Lus10026597 51 / 4e-08 AT1G66140 85 / 1e-20 zinc finger protein 4 (.1)
Lus10010388 51 / 8e-08 AT1G24625 88 / 4e-21 zinc finger protein 7 (.1)
Lus10006960 50 / 8e-08 AT5G57520 92 / 2e-24 zinc finger protein 2 (.1)
Lus10028997 50 / 1e-07 AT1G24625 103 / 1e-27 zinc finger protein 7 (.1)
PFAM info
Representative CDS sequence
>Potri.014G178200.1 pacid=42763530 polypeptide=Potri.014G178200.1.p locus=Potri.014G178200 ID=Potri.014G178200.1.v4.1 annot-version=v4.1
ATGGAACCCGAAGAAGAGGTCTGTCCAATCAACGCAGGAGAAGACACAACAGCACGAGTGTTTCCTTGTTTATTCTGTTCAAGAAAGTTTTACAGTTCTC
AAGCCTTAGGAGGCCACCAAAATGCTCACAAGAAGGAGAGAAATGCAGCAAGGAAGGCAAAAAGAGCATCTGAAATATTCCCACCACCAACATTCCCAAT
TATGTTTGCTCCTAGTCATCATTTAGGGCTCTTGCACCCTTCATTGTACAGAACTGCTCATGCAGCCACCCTCCCGTGTCCTCCTACTCACCAGTTTTCC
GATCGTTTTGGATCCAATAATGCAGCCAGGTTTGATAATGTGCTGTTTTATGGGAGCAGTAGGTATCGTCAATATGATCAAGAAGATGAGCAGAGTTTCT
TGAATTGGCAAAGAAGCGTAAGATTCAATGGATTCAACGAAGGTGGGTCCAACCAATATCTTTCAAGGGTGAACGGCAATCCCAACATGGGGATCAGGAA
TGATAAAGATCAGAAACTTGATTTGACTCTTCATTTATGA
AA sequence
>Potri.014G178200.1 pacid=42763530 polypeptide=Potri.014G178200.1.p locus=Potri.014G178200 ID=Potri.014G178200.1.v4.1 annot-version=v4.1
MEPEEEVCPINAGEDTTARVFPCLFCSRKFYSSQALGGHQNAHKKERNAARKAKRASEIFPPPTFPIMFAPSHHLGLLHPSLYRTAHAATLPCPPTHQFS
DRFGSNNAARFDNVLFYGSSRYRQYDQEDEQSFLNWQRSVRFNGFNEGGSNQYLSRVNGNPNMGIRNDKDQKLDLTLHL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G48890 C2H2ZnF LATE LATE FLOWERING, C2H2-like zinc... Potri.014G178200 0 1
AT3G14460 LRR and NB-ARC domains-contain... Potri.017G015000 10.00 0.8314
Potri.005G233101 11.13 0.8173
AT2G30470 B3 HSI2, VAL1 VP1/ABI3-LIKE 1, high-level ex... Potri.013G157500 15.42 0.7735
AT3G15220 Protein kinase superfamily pro... Potri.001G397600 16.06 0.8243
AT1G34270 Exostosin family protein (.1) Potri.019G086800 28.91 0.7704
AT2G01818 PLATZ transcription factor fam... Potri.010G103500 31.08 0.7658
AT1G27980 DPL1, ATDPL1 dihydrosphingosine phosphate l... Potri.001G059001 33.70 0.7174
AT2G37770 ChlAKR, AKR4C9 Chloroplastic aldo-keto reduct... Potri.016G102300 39.49 0.7936
Potri.010G219350 44.15 0.7211
AT1G79430 GARP WDY, APL WOODY, ALTERED PHLOEM DEVELOPM... Potri.011G023600 51.38 0.7620

Potri.014G178200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.