Plant FIBer expression Database

Potri.014G181400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76065 121 / 9e-38 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005622
[exp]
122 / 2e-38 AT1G76065 121 / 8e-38 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0491 LYR-like PF05347 Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence
>Potri.014G181400.2 pacid=42763683 polypeptide=Potri.014G181400.2.p locus=Potri.014G181400 ID=Potri.014G181400.2.v4.1 annot-version=v4.1
ATGGTTCTCTCGTTTGGTTTGCAGGACTTCATTCTCCGAGCTCGAGTGCTGAAACTGTATAGGCAAGCACTAAGGACTACAAGGAGAGCACCTGGTGACG
CTAGAGCTGACCTGAAACAAACAATTAGACAAGAGATGGAGAATAACCGGCATTGCAATGACAAGCAAAGGATTCGTTTTCTCATCAGTGAAGGATTAGA
GAGATTAAAACGTCTGGACGAGATGCTCGATATGCAGGGACATTCCCAGTGGACATAA
AA sequence
>Potri.014G181400.2 pacid=42763683 polypeptide=Potri.014G181400.2.p locus=Potri.014G181400 ID=Potri.014G181400.2.v4.1 annot-version=v4.1
MVLSFGLQDFILRARVLKLYRQALRTTRRAPGDARADLKQTIRQEMENNRHCNDKQRIRFLISEGLERLKRLDEMLDMQGHSQWT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G76065 LYR family of Fe/S cluster bio... Potri.014G181400
[exp]
0 1
AT4G24990 ATGP4 Ubiquitin family protein (.1) Potri.015G101200
[exp]
2.00 0.9057
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Potri.016G138800
[exp]
2.82 0.8698
AT2G04340 unknown protein Potri.001G240904
[exp]
2.82 0.8885
AT4G18060 SH3 domain-containing protein ... Potri.011G077500
[exp]
3.46 0.9039
AT5G64390 HEN4 HUA ENHANCER 4, RNA-binding KH... Potri.007G116300
[exp]
5.47 0.8813
AT5G45660 unknown protein Potri.011G076600
[exp]
8.12 0.8656
AT2G29540 ATRPAC14, ATRPC... RNApolymerase 14 kDa subunit (... Potri.001G246600
[exp]
11.83 0.7529 Pt-ATRPC14.1
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Potri.002G145200
[exp]
16.70 0.8310
AT4G24990 ATGP4 Ubiquitin family protein (.1) Potri.012G103100
[exp]
17.66 0.8644
AT5G27000 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABID... Potri.013G011500
[exp]
17.74 0.8669

Potri.014G181400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.