Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16230 277 / 7e-91 O-Glycosyl hydrolases family 17 protein (.1) AT4G34480 276 / 2e-90 O-Glycosyl hydrolases family 17 protein (.1) AT5G42720 268 / 2e-88 Glycosyl hydrolase family 17 protein (.1) AT5G24318 181 / 2e-54 O-Glycosyl hydrolases family 17 protein (.1.2) AT2G27500 171 / 5e-52 Glycosyl hydrolase superfamily protein (.1.2.3) AT1G32860 169 / 7e-50 Glycosyl hydrolase superfamily protein (.1) AT3G46570 162 / 4e-48 Glycosyl hydrolase superfamily protein (.1) AT3G15800 161 / 3e-47 Glycosyl hydrolase superfamily protein (.1) AT1G30080 161 / 5e-47 Glycosyl hydrolase superfamily protein (.1) AT4G18340 155 / 6e-45 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G182500 [exp] 374 / 5e-130 AT2G16230 504 / 4e-177 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G183800 [exp] 372 / 4e-129 AT2G16230 515 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G184300 [exp] 365 / 2e-126 AT2G16230 511 / 1e-179 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G184100 [exp] 357 / 1e-124 AT2G16230 362 / 1e-122 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G182800 [exp] 356 / 2e-122 AT2G16230 514 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G182321 [exp] 344 / 1e-117 AT2G16230 506 / 4e-177 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G182000 [exp] 343 / 1e-117 AT2G16230 506 / 2e-177 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G184400 [exp] 338 / 1e-117 AT2G16230 337 / 1e-113 O-Glycosyl hydrolases family 17 protein (.1) Potri.014G185100 [exp] 333 / 7e-114 AT2G16230 514 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032719 [exp] 289 / 2e-97 AT2G16230 430 / 4e-149 O-Glycosyl hydrolases family 17 protein (.1) Lus10012080 [exp] 287 / 3e-95 AT2G16230 564 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10023576 [exp] 281 / 5e-93 AT2G16230 644 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10040461 [exp] 280 / 1e-92 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10023245 [exp] 185 / 5e-56 AT5G24318 561 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10023120 [exp] 176 / 4e-54 AT3G15800 409 / 1e-143 Glycosyl hydrolase superfamily protein (.1) Lus10008865 [exp] 178 / 2e-53 AT5G24318 517 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Lus10011482 [exp] 176 / 1e-52 AT3G15800 540 / 0.0 Glycosyl hydrolase superfamily protein (.1) Lus10017344 [exp] 173 / 8e-52 AT1G32860 459 / 5e-161 Glycosyl hydrolase superfamily protein (.1) Lus10033244 [exp] 172 / 2e-51 AT1G32860 483 / 5e-170 Glycosyl hydrolase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [poplar] [flax] Glyco_hydro_tim PF00332 [poplar] [flax] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Potri.014G182166.1 pacid=42763163 polypeptide=Potri.014G182166.1.p locus=Potri.014G182166 ID=Potri.014G182166.1.v4.1 annot-version=v4.1 ATGAAGGGCTTGTTGGAGTTTAATAGTGCGAATGGTTCGCCTTTCGCAATCAATCCCTACCCTTACTTTGCCTACAGAAGCGATACAAGGCCTGAGACTC TTGCTTTATGCCTTTTCCAGCCGAATGCAGGACGAATGGATGGAAACACTAAGATCAAGTACATGAACATGTTCGATGCTCAGGTGGATGCAGTTTATTC TGCACTGAATTCTATGGGATTTAAGAATGTTGAGATTGTGGTGGCTGAGACTGGATGGCCATTTAAAGGAGATGACAACGACGTAGGGCCAAGCATTGAG AATGCCAAGGCTTACAATGGCAATTTGATTGCACACCTTCGATCGATGGTGGGCACTCCAGTCATGCCAGGAAAATCAGTGGATACATACCTCTTTGCTC TTTATGACGAAGAGTTGAAACCTGGACCTGGTTCTGAGCGATCATTTGGACTTTTCAAGACTGATCTCACCGTGGTTTATGATGTTGGACTCTCTACAAA TAGCCAGAACAAGTCACTAGAAGCAACACCACAACCGCCACCAGCAACCGCAGTCACTGCCACCAGCACTAGCACTAACAACAATGACAGCAGCACAAGC ATGGGCACAAGCACAAGCACGGGCTCGAGCATGAACACCATCAGCATCATCAACAAAGTATATTTAATTAGGATTTTCAATTTAGGTTTGTTGTCTGAGT ACATGGAACTTTCTTTGATTTTCTTTTTCTTTTATGACTTGCATACTTAG
AA sequence Show only first row Show all	>Potri.014G182166.1 pacid=42763163 polypeptide=Potri.014G182166.1.p locus=Potri.014G182166 ID=Potri.014G182166.1.v4.1 annot-version=v4.1 MKGLLEFNSANGSPFAINPYPYFAYRSDTRPETLALCLFQPNAGRMDGNTKIKYMNMFDAQVDAVYSALNSMGFKNVEIVVAETGWPFKGDDNDVGPSIE NAKAYNGNLIAHLRSMVGTPVMPGKSVDTYLFALYDEELKPGPGSERSFGLFKTDLTVVYDVGLSTNSQNKSLEATPQPPPATAVTATSTSTNNNDSSTS MGTSTSTGSSMNTISIINKVYLIRIFNLGLLSEYMELSLIFFFFYDLHT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182166 [exp]	0	1
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G183500 [exp]	1.73	0.9624
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184100 [exp]	4.69	0.9301
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182800 [exp]	6.00	0.9291
AT5G42720			Glycosyl hydrolase family 17 p...		Potri.014G183000 [exp]	8.00	0.9175
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184400 [exp]	8.06	0.9164
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182500 [exp]	9.79	0.9015
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184900 [exp]	11.22	0.9079
AT5G55980			serine-rich protein-related (....		Potri.001G371400 [exp]	11.61	0.8694
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G185100 [exp]	12.48	0.8873
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184300 [exp]	12.84	0.8885

Compare expression of checked genes

Potri.014G182166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.