Potri.014G182410 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G59780 126 / 2e-34 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G128300 163 / 1e-47 AT3G59780 610 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.019G098001 110 / 2e-30 AT3G59780 91 / 8e-21 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027050 112 / 3e-29 AT3G59780 562 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10025587 111 / 7e-29 AT3G59780 510 / 5e-173 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.014G182410.1 pacid=42762736 polypeptide=Potri.014G182410.1.p locus=Potri.014G182410 ID=Potri.014G182410.1.v4.1 annot-version=v4.1
ATGGGTCCGTCTCAGAATCCAATGCTCTTGGATCTTGCATCCTCACCCAAATGGTTCTTCAAGCGTGCTCTACTGCTCTCCCTCCACAACTCACTCAAGG
CTGGTTTTGATAATTTTTTGAGCGAGGTTAGGGACTCCATCAAAACTTCAGTAAATAAGGGAGGAAATGTTGTGCAAAGCTTACTAGACACAATTGCTTC
TTCAATAACATCGATTAAGGAAGGTGCTTCAGAAGCAGTAGATGGTGCCTTGAGTAAAGTATTCTCAAGTTTTGATCAAACAGGAGAATTAGTTGGTGAT
AGATTGACTAGCTTTTCATCTGGTTTGAGGGAAGCCACACAAAAAGCTACTGGCACTTCTGTAGATGTGCTCAGAGTTGCAATCGTTGTAGTGGAGGAAT
CTATAGCAAAAGGGGCTTCTTTTGTTGTTTATTCTTATGGGCCTGCCAAGAATTTGCTTCCTCCATAG
AA sequence
>Potri.014G182410.1 pacid=42762736 polypeptide=Potri.014G182410.1.p locus=Potri.014G182410 ID=Potri.014G182410.1.v4.1 annot-version=v4.1
MGPSQNPMLLDLASSPKWFFKRALLLSLHNSLKAGFDNFLSEVRDSIKTSVNKGGNVVQSLLDTIASSITSIKEGASEAVDGALSKVFSSFDQTGELVGD
RLTSFSSGLREATQKATGTSVDVLRVAIVVVEESIAKGASFVVYSYGPAKNLLPP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G59780 Rhodanese/Cell cycle control p... Potri.014G182410 0 1
AT5G28150 Plant protein of unknown funct... Potri.013G038000 5.00 0.7524
AT5G60230 ATSEN2, SEN2 splicing endonuclease 2 (.1.2) Potri.014G083401 8.36 0.7101
AT4G38180 FAR1_related FRS5 FAR1-related sequence 5 (.1) Potri.015G139300 8.48 0.7053
Potri.002G067900 16.24 0.7225
AT3G21100 RNA-binding (RRM/RBD/RNP motif... Potri.009G050600 20.44 0.6965
AT2G43770 Transducin/WD40 repeat-like su... Potri.013G128001 32.44 0.6274
AT1G76630 Tetratricopeptide repeat (TPR)... Potri.002G001700 54.68 0.6426
AT2G39910 ARM repeat superfamily protein... Potri.008G063500 61.44 0.6728
AT2G27040 OCP11, AGO4 OVEREXPRESSOR OF CATIONIC PERO... Potri.006G025900 89.59 0.6576 AGO913
AT1G55790 Domain of unknown function (DU... Potri.003G101200 104.79 0.6366

Potri.014G182410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.