Potri.014G186733 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G40390 69 / 1e-13 DNAse I-like superfamily protein (.1)
AT1G43760 65 / 6e-12 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G186236 313 / 4e-109 AT1G40390 86 / 2e-19 DNAse I-like superfamily protein (.1)
Potri.019G043150 269 / 2e-92 AT1G40390 58 / 3e-10 DNAse I-like superfamily protein (.1)
Potri.003G066101 231 / 5e-78 AT1G40390 62 / 1e-11 DNAse I-like superfamily protein (.1)
Potri.013G100901 209 / 8e-69 AT1G40390 43 / 6e-05 DNAse I-like superfamily protein (.1)
Potri.T124605 178 / 7e-57 ND /
Potri.015G069301 176 / 1e-55 AT1G43760 72 / 6e-15 DNAse I-like superfamily protein (.1)
Potri.005G153775 125 / 1e-34 AT1G40390 94 / 1e-21 DNAse I-like superfamily protein (.1)
Potri.004G128941 127 / 2e-34 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 127 / 2e-34 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0530 DNase_I-like PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence
>Potri.014G186733.1 pacid=42763532 polypeptide=Potri.014G186733.1.p locus=Potri.014G186733 ID=Potri.014G186733.1.v4.1 annot-version=v4.1
ATGAAGTTGTCTTCTTCCAAGGTTGCCTTTATGCAGAAATTTCTGCTAAAGAATTGGAAGTTTGTAAGTAATGCTGAGATTGCCAATACTGCGAGAATTG
TTTTATTGTGGAATCCTTCCACTATTAGTATTGAGGTTATTAATTTATCTGCCCAAGGTATTCATGTAGTCATTAATAATATGGTGACTCGATATTGTTT
TACTGCCACGTTTGTCTATGGTTATAACATTATTTCAGCTAGGAGAGCTCTCTGGGAAGATCTAAAGAGGTGGTGTCCTTCCTCACCATGGATTGTTCTT
GGTGACTTTAACTCTATTTTATCCCAGGATGACAAACATGACAAACATAATGGTGAACCTGTCTCTAGCTATGAAGTCCCTGATTTTAGGGAGTGCTGTG
CTGACCTTGGGCTTGCTGATTTGAATGCTACTGGTTGTCACTTCACCTGGTCCAATGGCAGTGTGTGGAGCAAGATTGATAGAGTTATGGTGAATCCCTT
ATGGTTCAGCTCACAGATGCAGACTCATGTTCATTTCTGCACTCTTGGGGCTTTCTCAGATCATTCTCCAACTTCAATCAAGATAGGGTTGAGACCTCTG
CCAGGCAAGCGGAACCTTAAATTCTTCAACATGTGGGCAGCTCATTCTAACTTTATGGAGTTGATTACTAACAATTGA
AA sequence
>Potri.014G186733.1 pacid=42763532 polypeptide=Potri.014G186733.1.p locus=Potri.014G186733 ID=Potri.014G186733.1.v4.1 annot-version=v4.1
MKLSSSKVAFMQKFLLKNWKFVSNAEIANTARIVLLWNPSTISIEVINLSAQGIHVVINNMVTRYCFTATFVYGYNIISARRALWEDLKRWCPSSPWIVL
GDFNSILSQDDKHDKHNGEPVSSYEVPDFRECCADLGLADLNATGCHFTWSNGSVWSKIDRVMVNPLWFSSQMQTHVHFCTLGAFSDHSPTSIKIGLRPL
PGKRNLKFFNMWAAHSNFMELITNN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G40390 DNAse I-like superfamily prote... Potri.014G186733 0 1
AT5G61630 unknown protein Potri.001G080500 5.47 0.6483
AT3G20190 Leucine-rich repeat protein ki... Potri.014G002700 11.31 0.6306
Potri.004G151301 18.33 0.6148
Potri.011G164750 19.59 0.5958
AT5G13930 ATCHS, TT4, CHS TRANSPARENT TESTA 4, CHALCONE ... Potri.003G195150 22.36 0.5679
AT1G14200 RING/U-box superfamily protein... Potri.011G119900 27.49 0.5611
AT3G63400 Cyclophilin-like peptidyl-prol... Potri.010G080800 30.51 0.4909
AT5G20950 Glycosyl hydrolase family prot... Potri.008G013700 31.98 0.5373
Potri.008G029550 36.93 0.4750
AT5G12000 Protein kinase protein with ad... Potri.006G225300 39.47 0.5067

Potri.014G186733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.