Potri.014G186866 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G188801 145 / 2e-45 AT1G43760 45 / 6e-06 DNAse I-like superfamily protein (.1)
Potri.004G128840 72 / 2e-16 AT1G43760 87 / 5e-20 DNAse I-like superfamily protein (.1)
Potri.015G069301 70 / 1e-15 AT1G43760 72 / 6e-15 DNAse I-like superfamily protein (.1)
Potri.004G128941 72 / 2e-15 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 72 / 2e-15 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128860 72 / 2e-15 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128880 72 / 2e-15 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128921 72 / 2e-15 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128901 72 / 2e-15 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G186866.1 pacid=42762332 polypeptide=Potri.014G186866.1.p locus=Potri.014G186866 ID=Potri.014G186866.1.v4.1 annot-version=v4.1
ATGTGGGTTGAGCATCAAGATTATAAATCTCTCCTCTTGAAGCACTGGCATACTGAGGTCTATGGCTCTCCAATGTATATATTATGTAGGCGGCTTAAGC
TTCTCAAGGGTCCCTTGAAGCAGCTCAACAAGTTTCATTTTGGCCACATTTCGGAGAGAGTCCGCAGGGCTGAAGTAAACCTGGAGCACCACCAATCTTT
ACTGCAAGACAATAGGAACAATGCTCAATTCCTAGCTCAAGATCACAAGCTTTGCCTGGAGCTTGTCAACCTTAAATCATCGAAGAAAATGTTCTATAGC
CAGAAATTGAAATGTAACTTGTTCAAGGATAGTGAAAGAGGGACTAGCTTTTTCCATGCCTTGATGAACCAGAAACATAAGAAGAACTTCATTCATGCTA
CTGGGTACTTCAAGCAGGAATGA
AA sequence
>Potri.014G186866.1 pacid=42762332 polypeptide=Potri.014G186866.1.p locus=Potri.014G186866 ID=Potri.014G186866.1.v4.1 annot-version=v4.1
MWVEHQDYKSLLLKHWHTEVYGSPMYILCRRLKLLKGPLKQLNKFHFGHISERVRRAEVNLEHHQSLLQDNRNNAQFLAQDHKLCLELVNLKSSKKMFYS
QKLKCNLFKDSERGTSFFHALMNQKHKKNFIHATGYFKQE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.014G186866 0 1
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Potri.013G153200 1.00 0.6973
AT3G60460 MYB DUO1 DUO POLLEN 1, myb-like HTH tra... Potri.014G054700 25.29 0.5270
AT5G44265 Bifunctional inhibitor/lipid-t... Potri.007G138400 41.42 0.5497
Potri.006G106300 50.91 0.5687
AT1G21280 unknown protein Potri.006G249450 80.00 0.4936
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Potri.001G113566 88.81 0.5560
AT3G54170 ATFIP37 FKBP12 interacting protein 37 ... Potri.002G197600 98.74 0.4944 ATFIP37.1
Potri.017G059701 98.97 0.5018
AT2G43900 Endonuclease/exonuclease/phosp... Potri.007G145100 99.23 0.5476
AT5G10820 Major facilitator superfamily ... Potri.018G017400 109.04 0.4930

Potri.014G186866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.