Potri.014G193150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20390 47 / 8e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G256700 76 / 1e-18 AT2G20390 195 / 8e-64 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.014G193150.2 pacid=42764715 polypeptide=Potri.014G193150.2.p locus=Potri.014G193150 ID=Potri.014G193150.2.v4.1 annot-version=v4.1
ATGTTGGCGAGAAGATTTATTTCCTTGTTCAAGGGCTCCCAAGCTTCCCAAATTCCGAGTGGAGTGAAGTCCTTGGATGAAGGAAAGAGCAAGTCATTTG
GTCGAAAGGCAGTGTCTTTTGTGTCGGTTACAGTCACGGGTGGTGTTGCTTTGAGTGCTCTTGATGATCTTGCTATTTATCATGGCTGTAGCAGGATTGG
GAAATTGATGCCTTGGAGACAATGTTGCTTTTGTTAG
AA sequence
>Potri.014G193150.2 pacid=42764715 polypeptide=Potri.014G193150.2.p locus=Potri.014G193150 ID=Potri.014G193150.2.v4.1 annot-version=v4.1
MLARRFISLFKGSQASQIPSGVKSLDEGKSKSFGRKAVSFVSVTVTGGVALSALDDLAIYHGCSRIGKLMPWRQCCFC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20390 unknown protein Potri.014G193150 0 1
AT3G21510 ATHP3, AHP1 histidine-containing phosphotr... Potri.005G040400 1.73 0.8712 Pt-HPT2.3
AT1G19310 RING/U-box superfamily protein... Potri.014G040400 4.00 0.7668
AT3G06890 unknown protein Potri.008G221000 4.58 0.8473
AT3G51030 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOX... Potri.007G018000 4.89 0.8010 Pt-TRXH.1,PtrTrxh4
AT4G39900 unknown protein Potri.007G093200 5.00 0.8196
AT1G43850 SEU SEUSS transcriptional co-regul... Potri.005G058501 7.74 0.7871
AT4G19400 Profilin family protein (.1) Potri.003G106700 11.22 0.7575
Potri.005G098650 12.00 0.7511
AT3G16300 Uncharacterised protein family... Potri.003G050400 12.36 0.7932
AT5G62850 ATVEX1, SWEET5,... VEGETATIVE CELL EXPRESSED1, No... Potri.015G074300 12.40 0.7530

Potri.014G193150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.