Potri.014G197400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07568 76 / 4e-20 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016081 85 / 7e-24 AT3G07568 78 / 5e-21 unknown protein
Lus10012305 81 / 2e-20 AT3G07570 165 / 8e-49 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
PFAM info
Representative CDS sequence
>Potri.014G197400.1 pacid=42763728 polypeptide=Potri.014G197400.1.p locus=Potri.014G197400 ID=Potri.014G197400.1.v4.1 annot-version=v4.1
ATGGTGAGGACGAGATTGGCGTGGTTCACAGTGGGATTTTCGGTATCAGCAGCTGCAATTTCACAATTCGCTTGGAGAGACCTTTTCAATCAAAGATATG
CCCTTTCTTATCATATGAACCAGAAATTTGAGGACCTTGAAGCTAGAGTCCTGAATCTGGAGTCTTTTTCTCCCCAGAACTCTAATCAGACAACCCAGGT
TGACAGTTAG
AA sequence
>Potri.014G197400.1 pacid=42763728 polypeptide=Potri.014G197400.1.p locus=Potri.014G197400 ID=Potri.014G197400.1.v4.1 annot-version=v4.1
MVRTRLAWFTVGFSVSAAAISQFAWRDLFNQRYALSYHMNQKFEDLEARVLNLESFSPQNSNQTTQVDS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G07568 unknown protein Potri.014G197400 0 1
AT5G08040 TOM5 mitochondrial import receptor ... Potri.015G058500 1.41 0.8022
Potri.012G127000 2.44 0.7786
AT3G01130 unknown protein Potri.009G125832 4.47 0.7234
AT1G48635 PEX3-2, PEX3 PEROXIN 3-2, peroxin 3 (.1.2) Potri.012G049700 6.24 0.6750 Pt-PP2.6
AT5G19680 Leucine-rich repeat (LRR) fami... Potri.006G163900 13.60 0.7150
AT1G79070 SNARE-associated protein-relat... Potri.011G144400 13.78 0.6576
AT1G04960 Protein of unknown function (D... Potri.002G219300 16.12 0.6855
AT2G40620 bZIP AtbZIP18 Basic-leucine zipper (bZIP) tr... Potri.013G091400 17.83 0.7140
AT3G11150 2-oxoglutarate (2OG) and Fe(II... Potri.008G069800 18.24 0.6863
AT2G20390 unknown protein Potri.014G193150 19.07 0.7069

Potri.014G197400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.