Potri.015G002001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04230 59 / 9e-10 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT5G56690 56 / 1e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT4G10400 54 / 4e-08 F-box/RNI-like/FBD-like domains-containing protein (.1.2)
AT1G32020 52 / 4e-08 F-box family protein (.1)
AT5G38570 53 / 8e-08 F-box/RNI-like superfamily protein (.1)
AT4G09920 52 / 1e-07 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT3G26922 52 / 1e-07 F-box/RNI-like superfamily protein (.1)
AT5G38565 52 / 2e-07 F-box/FBD-like domains containing protein (.1)
AT2G39415 49 / 2e-07 F-box family protein (.1)
AT5G53840 52 / 3e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G011200 130 / 4e-35 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.015G002100 128 / 2e-34 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.001G337200 81 / 5e-17 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
Potri.011G104200 61 / 2e-10 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G104100 55 / 2e-08 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.014G039700 54 / 4e-08 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1)
Potri.001G322900 54 / 8e-08 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
Potri.011G104300 53 / 1e-07 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.002G132400 53 / 1e-07 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020748 70 / 2e-13 AT3G28410 73 / 4e-14 F-box/RNI-like superfamily protein (.1)
Lus10020292 64 / 2e-11 AT1G60410 76 / 9e-15 F-box family protein (.1)
Lus10014161 62 / 1e-10 AT5G53840 64 / 4e-11 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10008295 60 / 1e-10 AT1G78840 67 / 2e-13 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10023425 60 / 3e-10 AT5G56440 61 / 2e-10 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10029433 58 / 2e-09 AT3G18150 79 / 8e-16 RNI-like superfamily protein (.1)
Lus10024695 57 / 4e-09 AT1G69630 83 / 3e-17 F-box/RNI-like superfamily protein (.1)
Lus10038967 57 / 5e-09 AT3G18150 77 / 9e-15 RNI-like superfamily protein (.1)
Lus10006319 56 / 5e-09 AT1G69630 67 / 2e-12 F-box/RNI-like superfamily protein (.1)
Lus10016192 57 / 6e-09 AT3G26922 68 / 1e-12 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.015G002001.1 pacid=42775394 polypeptide=Potri.015G002001.1.p locus=Potri.015G002001 ID=Potri.015G002001.1.v4.1 annot-version=v4.1
ATGATAAACATAGACAGATTGAATGATCTACCTGACCACGTTATCCATAAAGTTCTGTCTTTCCTTTACCTCAAACAGGCAATCCAAACTTGTGTGCTTT
CTAAGCGATGGAGATTCCCGTGGACTTCTCTTCCCTGTCTCAAATTTGATAGCTACCATTTCGTCACCAAGGTACCGTCTCACCGTGATAATTCCTTCAC
GTCTAAATCATTGAAAACCCTTGAATTGTCTTCTGTTGCTTTCTATCGTATGCCTGAATCTCTTGCCTTGGGTTTGGCAAATCTGACCTCCTTGAATCTC
AACCATTGTTTAATATCATATGAAACCGATTTGTTCGATGACCCTTTTGCTGCTTGTTCCAATCTCAGGAGTTTATGTCTGCGCCATTGTAGCTTTTACC
GTCTTAAGGTTTTAAGAATATCCGGACTCCAACTAGCTAACCTAGATACTCAAGGCTGGTTCCATTCTAATAGTTGTTGTAACAGGATTGAGATTTTCAC
ACCGAAACTCACATCCTTTCGCTATAGTCATTCACGTCCTGTGGATTTCTCTCGGCTCGACCTCCCCTCCCCTCTCTTAATTTTGCTGATATTCATAGGG
CTACACAATGCACGATTTGTAAGGATATCTTCTGAGACCATTGAGGTCCTCAATTTGGTTCCTGGCTTACAAGCACGACAGACCTGCCCCTTCAAAAGAT
TGAAGTCTTTGAAAGTGCATGGCGAGGATAACTCGTTTGTGATACCTGATCATGTGCAGATCTACTTACTTGGTGATGAACTCCCTGAAGAAACCTTACA
CATGGAAGGCAGTTTTCTTGCAGAACCGGGGGATCATACGGATCACCTATCCACATCCCTGCTCGCGGATCTCACAAGACTTTAA
AA sequence
>Potri.015G002001.1 pacid=42775394 polypeptide=Potri.015G002001.1.p locus=Potri.015G002001 ID=Potri.015G002001.1.v4.1 annot-version=v4.1
MINIDRLNDLPDHVIHKVLSFLYLKQAIQTCVLSKRWRFPWTSLPCLKFDSYHFVTKVPSHRDNSFTSKSLKTLELSSVAFYRMPESLALGLANLTSLNL
NHCLISYETDLFDDPFAACSNLRSLCLRHCSFYRLKVLRISGLQLANLDTQGWFHSNSCCNRIEIFTPKLTSFRYSHSRPVDFSRLDLPSPLLILLIFIG
LHNARFVRISSETIEVLNLVPGLQARQTCPFKRLKSLKVHGEDNSFVIPDHVQIYLLGDELPEETLHMEGSFLAEPGDHTDHLSTSLLADLTRL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G04230 FBD, F-box and Leucine Rich Re... Potri.015G002001 0 1
AT5G63840 PSL5, RSW3 RADIAL SWELLING 3, PRIORITY IN... Potri.005G069000 3.87 0.8540
AT4G22740 glycine-rich protein (.1.2) Potri.001G117400 13.41 0.8442
AT5G04010 F-box family protein (.1) Potri.004G077301 14.96 0.8339
AT1G04840 Tetratricopeptide repeat (TPR)... Potri.001G316500 18.33 0.8467
Potri.003G088350 25.19 0.8433
AT5G28460 Pentatricopeptide repeat (PPR)... Potri.014G090400 26.45 0.8442
AT2G26140 FTSH4 FTSH protease 4 (.1) Potri.006G227700 27.71 0.8036 Pt-FTSH4.1
AT4G36650 ATPBRP plant-specific TFIIB-related p... Potri.007G027600 30.93 0.8244
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.014G093801 32.03 0.8056
AT3G24000 Tetratricopeptide repeat (TPR)... Potri.006G001200 32.03 0.8326

Potri.015G002001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.