Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53730 228 / 5e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G44220 145 / 1e-43 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 132 / 1e-38 NHL1 NDR1/HIN1-like 1 (.1) AT3G52470 130 / 6e-38 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22200 124 / 2e-35 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35960 122 / 8e-35 NHL12 NDR1/HIN1-like 12 (.1) AT5G06330 117 / 9e-33 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35970 112 / 9e-31 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G09590 108 / 4e-29 NHL22 NDR1/HIN1-like 22 (.1) AT4G01410 89 / 2e-21 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G006000 [exp] 338 / 7e-120 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G019600 [exp] 139 / 2e-41 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071500 [exp] 129 / 2e-37 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.006G204200 [exp] 127 / 2e-36 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.005G088000 [exp] 99 / 7e-26 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 92 / 4e-23 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 91 / 1e-22 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 70 / 1e-14 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G003800 [exp] 68 / 6e-14 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032932 [exp] 216 / 5e-71 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021286 [exp] 131 / 3e-38 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 130 / 6e-38 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10004202 [exp] 125 / 7e-36 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1) Lus10029406 [exp] 120 / 4e-34 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 118 / 6e-33 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034175 [exp] 114 / 2e-31 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10013327 [exp] 90 / 6e-22 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10000157 [exp] 86 / 2e-20 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10030193 [exp] 83 / 6e-19 AT4G01410 185 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.015G002400.1 pacid=42774895 polypeptide=Potri.015G002400.1.p locus=Potri.015G002400 ID=Potri.015G002400.1.v4.1 annot-version=v4.1 ATGTCTCAAGTCTCCATAAAATCTCCAAAACACTGTGCTAAGCAAGGACTTAACTTCGACAAGCTCTACAAAAAGCTTTTCTTTGCCTTCTCAGGAATCT TTACCACTCTTCTCTTACTAATACTGATGATCTGGCTTATCCTGCGACCTGCCAAGCCTGAGTTCACTCTCAAAGAGGCTGATATCTACCAACTCAGCCT CTCTGGTCCTAACCTTCTCAACTCCTCTATCCAACTCACCCTACTTTCTAAGAACCCAAATCAAAAGGTCAGCATTTACTACGACGAGTTACAAGTTTAT GCTGCCTACAAGGGTCAACAGATAACTGTTGACACCTTCGTTCCCCCATTCTACCAAGGACATCAGGATAGCAATCTATTAACAGCATCTTTGGTTGGAA CTGGATTACCTGTGGCTCCATCCTTCAATTACGAAGTGGGGCGTGATCGAACTGCTGGAAAACTAGTTCTAAATCTAAAGGTGAATGGAAGAATCAGGTG GAAGGTCGGAACATGGGTTTCAGGGCCATACAGAATTAATGTTAATTGCCTTGCTGTTATGGCTCTTGGACCTACTCTCCCAACAGGACCTTTGAGTTCA AGGCAAGGGACTATATGTTCCACCACTGTCTGA
AA sequence Show only first row Show all	>Potri.015G002400.1 pacid=42774895 polypeptide=Potri.015G002400.1.p locus=Potri.015G002400 ID=Potri.015G002400.1.v4.1 annot-version=v4.1 MSQVSIKSPKHCAKQGLNFDKLYKKLFFAFSGIFTTLLLLILMIWLILRPAKPEFTLKEADIYQLSLSGPNLLNSSIQLTLLSKNPNQKVSIYYDELQVY AAYKGQQITVDTFVPPFYQGHQDSNLLTASLVGTGLPVAPSFNYEVGRDRTAGKLVLNLKVNGRIRWKVGTWVSGPYRINVNCLAVMALGPTLPTGPLSS RQGTICSTTV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53730			Late embryogenesis abundant (L...		Potri.015G002400 [exp]	0	1
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Potri.003G185776 [exp]	7.93	0.8450
AT3G07510			unknown protein		Potri.014G176300 [exp]	13.03	0.8689
AT3G27030			unknown protein		Potri.015G098200 [exp]	14.00	0.8582
AT1G19090		CRK1, RKF2	CYSTEINE-RICH RLK \(RECEPTOR-L...		Potri.015G079200 [exp]	15.39	0.7440
					Potri.017G050200 [exp]	15.62	0.7991
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.001G396100 [exp]	20.71	0.8663
AT1G76130		ATAMY2, AMY2	ARABIDOPSIS THALIANA ALPHA-AMY...		Potri.002G014300 [exp]	26.45	0.8286
AT2G46630			unknown protein		Potri.002G175400 [exp]	26.94	0.8587
					Potri.008G031601 [exp]	29.24	0.8572
					Potri.011G102400 [exp]	30.00	0.8619

Compare expression of checked genes

Potri.015G002400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.