Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24530 521 / 0 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 375 / 4e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 372 / 9e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 240 / 6e-77 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 236 / 3e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 229 / 1e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G51240 228 / 4e-72 TT6, F3'H, F3H TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) AT2G38240 224 / 1e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 222 / 1e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 216 / 2e-67 ATJRG21 jasmonate-regulated gene 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G006300 [exp] 664 / 0 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 404 / 2e-141 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 399 / 2e-139 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 384 / 1e-133 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451700 [exp] 357 / 4e-123 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 313 / 8e-106 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 290 / 2e-96 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150200 [exp] 287 / 1e-95 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G039500 [exp] 280 / 8e-93 AT4G10500 244 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032930 [exp] 541 / 0 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 538 / 0 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 377 / 8e-131 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 275 / 2e-90 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 270 / 4e-89 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 265 / 6e-87 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 234 / 4e-74 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 231 / 3e-73 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041913 [exp] 225 / 3e-71 AT3G51240 602 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) Lus10004808 [exp] 225 / 4e-71 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.015G002800.1 pacid=42776326 polypeptide=Potri.015G002800.1.p locus=Potri.015G002800 ID=Potri.015G002800.1.v4.1 annot-version=v4.1 ATGGATACAAAAGTAATTTCCTCTGGCGTCCATTACACGAACTTGCCGGCTAGCTATGTTAGGCCGGAATCTGAGCGTCCCAGGCTGTCGGAAGTTTCAA CGTGCGAAGATGTTCCGGTTATAGATTTAGGTTGTCAGGATAGGAACCAAATTGTCCAACAAGTTGGTGATGCCTGCGAGCACTATGGCTTTTTCCAGGT GATCAATCATGGAGTGTCCTTGGAAGCGGTGGAGAAAATGTTAGGAGTGGCCCATGATTTCTTCAGCTTGCCGGTTGAGGAGAAGCTGAAGCTGTACTCA GATGACCCATCAAAGACAATGAGACTTTCTACAAGTTTTAATGTGAATAAGGAAAAGGTCCACAACTGGAGGGATTATCTTAGACTCCATTGCTACCCTC TTGACAAATATGTGCCTGAGTGGCCTTCTAATCCTCCTCCTTTCAAGGAAATTGTAAGGAGTTACAGTATACAAGTTCGAGAACTGGGGTTTAGAATACA GGAACTGATATCAGAGAGCTTAGGCCTCGAAAAGGATCACATAAAAAATGTTTTGGGTGAACAAGGACAGCATATGGCTGTAAACTTTTACCCTCCATGT CCAGAGCCAGAGTTGACTTATGGATTGCCAGCACATACAGACCCCAATGCCCTAACAATTTTACTTCAAGACCTATCAGTGGCAGGCCTTCAAGTCCTCC TCAAAGATGGAAAGTGGGTTGCCGTTAATCCTCATCCGGATGCATTTGTCATCAACATTGGTGACCAGTTACAGGCACTAAGCAATGGAAGATATAAGAG TGTGTGGCACCGAGCCATTACCAATACTGACAAGGCAAGAATGTCAGTTGCTTCCTTCCTCTGTCCGTTTGATAACGCATTGATCACCCCACCTAAAGCT CTCACCGATGATGGAACCGGAGCCATATACAGGGATTTCACGTATGCTGAATATTACAAGAAGTTTTGGAGCAGGAACTTGGATCAAGAACATTGTTTGG AACTTTTCAAGAACTAA
AA sequence Show only first row Show all	>Potri.015G002800.1 pacid=42776326 polypeptide=Potri.015G002800.1.p locus=Potri.015G002800 ID=Potri.015G002800.1.v4.1 annot-version=v4.1 MDTKVISSGVHYTNLPASYVRPESERPRLSEVSTCEDVPVIDLGCQDRNQIVQQVGDACEHYGFFQVINHGVSLEAVEKMLGVAHDFFSLPVEEKLKLYS DDPSKTMRLSTSFNVNKEKVHNWRDYLRLHCYPLDKYVPEWPSNPPPFKEIVRSYSIQVRELGFRIQELISESLGLEKDHIKNVLGEQGQHMAVNFYPPC PEPELTYGLPAHTDPNALTILLQDLSVAGLQVLLKDGKWVAVNPHPDAFVINIGDQLQALSNGRYKSVWHRAITNTDKARMSVASFLCPFDNALITPPKA LTDDGTGAIYRDFTYAEYYKKFWSRNLDQEHCLELFKN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Potri.015G002800 [exp]	0	1
AT5G24520		ATTTG1, URM23, ...	UNARMED 23, TRANSPARENT TESTA ...		Potri.015G002600 [exp]	5.91	0.7852
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Potri.009G082900 [exp]	7.00	0.8112	PR1.1
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Potri.006G109100 [exp]	7.07	0.8095
					Potri.003G101700 [exp]	13.96	0.8018
AT1G59970			Matrixin family protein (.1)		Potri.019G073700 [exp]	14.69	0.7474
AT1G01980		ATSEC1A	FAD-binding Berberine family p...		Potri.011G158500 [exp]	20.49	0.7878
AT3G20600		NDR1	non race-specific disease resi...		Potri.001G418000 [exp]	21.44	0.7568
AT5G07610			F-box family protein (.1)		Potri.001G181000 [exp]	35.66	0.7695
					Potri.001G078000 [exp]	38.61	0.7565
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Potri.019G055200 [exp]	40.02	0.7600

Compare expression of checked genes

Potri.015G002800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.