Potri.015G003300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49470 172 / 4e-54 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 168 / 3e-52 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 161 / 8e-50 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
AT3G12390 150 / 3e-45 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 146 / 7e-44 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G006700 197 / 1e-63 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.001G034400 147 / 4e-44 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.003G190800 145 / 1e-43 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 139 / 3e-41 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015579 187 / 1e-59 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10032927 183 / 4e-58 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10026133 148 / 1e-45 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10041610 148 / 7e-45 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10024109 144 / 7e-44 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 131 / 6e-36 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.015G003300.1 pacid=42775925 polypeptide=Potri.015G003300.1.p locus=Potri.015G003300 ID=Potri.015G003300.1.v4.1 annot-version=v4.1
ATGTCACCCGGTCCCGTCGTTGAGGCTGAACCCGCCGCCTTCTCCACCACCGAGGAGGTGAAGTCAACTGTGGAAGAGACTCTGCAAAAGAAGCCTCCTC
AGCAGAACGAGGATGAGCCTGTTGTGGAGGACGTGAAAGAAGATGAGAAGGACGATGAGGATGAAGACGAGGATGATGAGGACGAGGACGATGATGATGA
CACCCCCGGTGCTAATGGGAGTTCAAAGCAGAGCAGAAGTGAAAAGAAGAGTCGCAAGGCAATGTTGAAGCTTGGCATGAAACCTGTTACTGGTGTTAGC
AGGGTCACTATCAAGAGGACCAAAAATATACTCTTTTTTATCTCAAAGCCAGATGTCTTCAAGAGCCCAAATTCTGAGACTTATGTCATATTCGGAGAGG
CTAAGATAGAGGATTTGAGCTCTCAGCTGCAGACACAGGCTGCTCAGCAGTTTAGGATGCCAGACATGTCATCTATGTTACCAAAATCAGATGCTTCTAC
TGCAGCTGCTTCAGCACCACCAGAGGAAGAAGAGGAAGAAGTCGATGATACTGGGGTGGAGCCTAGGGACATTGATCTGGTTATGACACAGGCTGGGGTT
TCTAGGACCAAGGCTGTCAAGGCTCTCCAGACAAACAATGGGGACATTGTCAGCGCTATCATGGAGCTTACTACTTAG
AA sequence
>Potri.015G003300.1 pacid=42775925 polypeptide=Potri.015G003300.1.p locus=Potri.015G003300 ID=Potri.015G003300.1.v4.1 annot-version=v4.1
MSPGPVVEAEPAAFSTTEEVKSTVEETLQKKPPQQNEDEPVVEDVKEDEKDDEDEDEDDEDEDDDDDTPGANGSSKQSRSEKKSRKAMLKLGMKPVTGVS
RVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIEDLSSQLQTQAAQQFRMPDMSSMLPKSDASTAAASAPPEEEEEEVDDTGVEPRDIDLVMTQAGV
SRTKAVKALQTNNGDIVSAIMELTT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G49470 NACA2 nascent polypeptide-associated... Potri.015G003300 0 1
AT2G33340 MAC3B MOS4-associated complex 3B (.... Potri.008G171600 3.00 0.8011
AT4G11240 TOPP7 Calcineurin-like metallo-phosp... Potri.001G098600 3.16 0.7595 PP1.4
AT3G03190 ATGSTF6, ATGSTF... ARABIDOPSIS GLUTATHIONE-S-TRAN... Potri.002G015200 4.24 0.7903
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Potri.016G087900 4.89 0.7953
AT3G09860 unknown protein Potri.016G092100 7.74 0.8159
AT1G26340 B5 #6, B5#6, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Potri.010G156900 8.36 0.7447 B5.2
AT2G02470 Alfin AL6 alfin-like 6 (.1.2) Potri.003G044700 9.79 0.7234
AT4G26300 EMB1027 embryo defective 1027, Arginyl... Potri.002G198500 10.19 0.7696
AT2G14260 PIP proline iminopeptidase (.1.2) Potri.001G287700 11.61 0.7082
AT5G46160 Ribosomal protein L14p/L23e fa... Potri.010G022800 16.61 0.7535 RPL14.1

Potri.015G003300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.