Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27590 141 / 6e-44 Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 60 / 2e-11 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT3G56891 56 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 57 / 3e-10 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G08570 52 / 4e-09 Heavy metal transport/detoxification superfamily protein (.1) AT3G53530 53 / 6e-09 NAKR3 SODIUM POTASSIUM ROOT DEFECTIVE 3, Chloroplast-targeted copper chaperone protein (.1.2) AT1G06330 51 / 1e-08 Heavy metal transport/detoxification superfamily protein (.1) AT1G66240 48 / 7e-08 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT5G27690 48 / 3e-07 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 45 / 2e-06 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G007200 [exp] 218 / 2e-74 AT4G27590 137 / 2e-42 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114600 [exp] 55 / 4e-10 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 55 / 4e-10 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.016G080400 [exp] 56 / 7e-10 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.005G167000 [exp] 54 / 8e-10 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 52 / 3e-09 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G213900 [exp] 54 / 4e-09 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.001G452400 [exp] 52 / 6e-09 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 52 / 6e-09 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032924 [exp] 123 / 5e-36 AT4G27590 122 / 4e-35 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016436 [exp] 57 / 6e-11 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 57 / 6e-11 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 56 / 2e-10 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 56 / 3e-10 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10025294 [exp] 55 / 1e-09 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10024435 [exp] 55 / 1e-09 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10016708 [exp] 51 / 1e-08 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10013911 [exp] 50 / 3e-08 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10033250 [exp] 50 / 5e-08 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.015G003800.1 pacid=42775927 polypeptide=Potri.015G003800.1.p locus=Potri.015G003800 ID=Potri.015G003800.1.v4.1 annot-version=v4.1 ATGGCAAGCATGCAAATTGTTCTAGCTTCCAGCTGCAAGAATGTTGAGGCACAGCACGTGGAGATGATGGTCCCTCTTTACTCCCATGGATGCGAGAAGA AGGTGAAGAAGACCTTATCCCATCTCAAAGGAATTTACTCCGTAAATGTAGATTATTATCAGCAAAAGGTGACGGTATGGGGAATATGCAACAAACATGA TGTATTGGCAACCATAAAGAGCAAAAGAAAGGAAGCTCGCTTTTGGAATCCCCAAGAAATGGAAGAAGAAGAATCACAACCACCGTCTCCGCCGCCGCCA CCACCAAAAGACTCCAGTACTATTCCTTCTTTGACTCTAATGAAGGCTCGTTCCCTAACTCGTTCCTTAAGTTGGAAAGTATGGAAAAAGGTCTTCACGA GAACCTATTCCTTCTAA
AA sequence Show only first row Show all	>Potri.015G003800.1 pacid=42775927 polypeptide=Potri.015G003800.1.p locus=Potri.015G003800 ID=Potri.015G003800.1.v4.1 annot-version=v4.1 MASMQIVLASSCKNVEAQHVEMMVPLYSHGCEKKVKKTLSHLKGIYSVNVDYYQQKVTVWGICNKHDVLATIKSKRKEARFWNPQEMEEEESQPPSPPPP PPKDSSTIPSLTLMKARSLTRSLSWKVWKKVFTRTYSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27590			Heavy metal transport/detoxifi...		Potri.015G003800 [exp]	0	1
AT3G48270		CYP71A26	"cytochrome P450, family 71, s...		Potri.015G085800 [exp]	1.41	0.9387	Pt-CYP71.2
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Potri.010G208600 [exp]	2.00	0.9350
AT1G18400	bHLH	bHLH044, BEE1	BR enhanced expression 1 (.1)		Potri.004G099400 [exp]	2.82	0.8748
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Potri.001G435900 [exp]	3.46	0.9143	Pt-PSPK3.1
AT1G22370		ATUGT85A5	UDP-glucosyl transferase 85A5 ...		Potri.006G023700 [exp]	4.89	0.8923
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.011G114500 [exp]	7.74	0.8976
AT1G60010			unknown protein		Potri.010G095400 [exp]	7.74	0.8672
AT1G75640			Leucine-rich receptor-like pro...		Potri.002G027400 [exp]	8.66	0.8421
					Potri.006G037900 [exp]	9.59	0.8459
AT1G65920			Regulator of chromosome conden...		Potri.004G080900 [exp]	10.24	0.8558

Compare expression of checked genes

Potri.015G003800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.