Plant FIBer expression Database

Potri.015G006500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53650 78 / 7e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G022900
[exp]
103 / 3e-31 AT5G53650 82 / 2e-22 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032946
[exp]
81 / 6e-22 AT5G53650 110 / 6e-34 unknown protein
Lus10008848
[exp]
80 / 2e-21 AT5G53650 109 / 2e-33 unknown protein
PFAM info
Representative CDS sequence
>Potri.015G006500.1 pacid=42776546 polypeptide=Potri.015G006500.1.p locus=Potri.015G006500 ID=Potri.015G006500.1.v4.1 annot-version=v4.1
ATGGGTTACGTATTGAGAGTAAGATTGGCTTCATTCTTTGCAGGAGCAGCAACAGCATCATTTGCAGGACTCTATCTCCTTTACAAAGATTTCAAGGTTG
CCCATGATGCCATCTCTCAACAGGTGGAAAGCGTTCATGAGTCACTGGATAGACGGATCTCTAATTTGGAAAAATTGAAACAAAATGAAGCTTCACAACC
TCTGCAAGCAGCAGAGTAG
AA sequence
>Potri.015G006500.1 pacid=42776546 polypeptide=Potri.015G006500.1.p locus=Potri.015G006500 ID=Potri.015G006500.1.v4.1 annot-version=v4.1
MGYVLRVRLASFFAGAATASFAGLYLLYKDFKVAHDAISQQVESVHESLDRRISNLEKLKQNEASQPLQAAE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G53650 unknown protein Potri.015G006500
[exp]
0 1
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Potri.008G097000
[exp]
2.23 0.9221
AT5G15770 ATGNA1 glucose-6-phosphate acetyltran... Potri.018G086400
[exp]
3.46 0.9220
AT5G59410 Rab5-interacting family protei... Potri.009G032100
[exp]
8.48 0.9184
AT4G35410 Clathrin adaptor complex small... Potri.014G079000
[exp]
10.09 0.9205 AP19.1
AT5G39510 ZIG1, SGR4, ATV... SHOOT GRAVITROPSIM 4, VESICLE ... Potri.004G115700
[exp]
10.19 0.9104
AT1G49140 Complex I subunit NDUFS6 (.1) Potri.012G056900
[exp]
10.39 0.9131
AT1G21930 unknown protein Potri.002G086300
[exp]
11.66 0.8658
AT5G05080 ATUBC22, UBC22 ubiquitin-conjugating enzyme 2... Potri.006G026900
[exp]
12.40 0.9016
AT3G01390 AVMA10, VMA10 vacuolar membrane ATPase 10 (.... Potri.010G222000
[exp]
14.38 0.9051 VMA10.2
AT3G09800 SNARE-like superfamily protein... Potri.001G197200
[exp]
15.49 0.9173

Potri.015G006500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.