Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) AT4G00880 122 / 2e-37 SAUR-like auxin-responsive protein family (.1) AT3G61900 116 / 2e-34 SAUR-like auxin-responsive protein family (.1) AT5G53590 91 / 1e-24 SAUR-like auxin-responsive protein family (.1) AT5G20810 79 / 9e-20 SAUR-like auxin-responsive protein family (.1.2) AT3G60690 74 / 8e-18 SAUR-like auxin-responsive protein family (.1) AT3G03850 71 / 2e-17 SAUR-like auxin-responsive protein family (.1) AT2G24400 73 / 3e-17 SAUR-like auxin-responsive protein family (.1) AT3G43120 73 / 3e-17 SAUR-like auxin-responsive protein family (.1) AT2G21210 70 / 7e-17 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G023400 [exp] 163 / 3e-53 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 140 / 1e-44 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 134 / 9e-42 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 81 / 4e-20 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 79 / 3e-19 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 76 / 8e-19 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 77 / 1e-18 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 75 / 3e-18 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 73 / 6e-18 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010110 [exp] 98 / 3e-27 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 97 / 1e-26 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 93 / 4e-25 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 79 / 1e-19 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 77 / 2e-19 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 74 / 3e-18 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 74 / 4e-18 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 76 / 5e-18 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 73 / 7e-18 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 73 / 8e-18 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.015G006800.1 pacid=42776648 polypeptide=Potri.015G006800.1.p locus=Potri.015G006800 ID=Potri.015G006800.1.v4.1 annot-version=v4.1 ATGGGGAGTGGGGATAAACTCCATTTGAATTTCCATATTCACTTGCCAAAAAACCACCACCACCACCACCACCACAGGAAGAAAGAGTTGAAAGATATCC CAAAAGGGTGTCTTGCTGTCATGGTAGGTCAAGGTGAGGAGCAACAAAGGTTTGTGATTCCTGTGATTTATATAAATCATCCACTCTTCATGCACCTGTT GAAAGAAGCTGAGGAAGAGTTTGGATTTGATCAACAAGGCCCCATCACTATTCCTTGTCATGTTGAGGAGTTTCGCAATATTGTTCAAGGCATGATCGAA GAGGAGAATTCCCAGTATCACCACCACCACTATCATGTTTGGTGCTTTAGGGTTTGA
AA sequence Show only first row Show all	>Potri.015G006800.1 pacid=42776648 polypeptide=Potri.015G006800.1.p locus=Potri.015G006800 ID=Potri.015G006800.1.v4.1 annot-version=v4.1 MGSGDKLHLNFHIHLPKNHHHHHHHRKKELKDIPKGCLAVMVGQGEEQQRFVIPVIYINHPLFMHLLKEAEEEFGFDQQGPITIPCHVEEFRNIVQGMIE EENSQYHHHHYHVWCFRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46690			SAUR-like auxin-responsive pro...		Potri.015G006800 [exp]	0	1
AT1G48320			Thioesterase superfamily prote...		Potri.010G003600 [exp]	1.41	0.8938
AT5G35960			Protein kinase family protein ...		Potri.014G136300 [exp]	2.82	0.9194
AT5G13500			unknown protein		Potri.001G028100 [exp]	7.34	0.8923
AT1G61330			FBD, F-box and Leucine Rich Re...		Potri.011G042900 [exp]	7.93	0.8711
AT3G15810			Protein of unknown function (D...		Potri.006G067000 [exp]	8.48	0.8882
AT3G05580		TOPP9	type one protein phosphatase 9...		Potri.013G014700 [exp]	13.49	0.8406
AT5G36000			unknown protein		Potri.014G098300 [exp]	13.56	0.8697
AT3G13275			unknown protein		Potri.011G166250 [exp]	14.69	0.8820
AT5G27840		TOPP8	Calcineurin-like metallo-phosp...		Potri.005G024100 [exp]	15.16	0.8237	Pt-TOPP8.1
AT3G03160			unknown protein		Potri.015G035400 [exp]	15.62	0.7223

Compare expression of checked genes

Potri.015G006800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.