Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33480 100 / 6e-26 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT5G13180 94 / 1e-23 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT5G46590 92 / 7e-23 NAC ANAC096 NAC domain containing protein 96 (.1) AT5G17260 93 / 2e-22 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G69490 89 / 1e-21 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT1G56010 89 / 2e-21 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT4G17980 88 / 2e-21 NAC ANAC071 NAC domain containing protein 71 (.1) AT4G36160 89 / 4e-21 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2, NAC domain containing protein 76 (.1) AT1G34190 89 / 6e-21 NAC ANAC017 NAC domain containing protein 17 (.1) AT3G17730 86 / 9e-21 NAC ANAC057 NAC domain containing protein 57 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G023900 [exp] 266 / 1e-92 AT5G17260 89 / 7e-21 NAC domain containing protein 86 (.1) Potri.012G024200 [exp] 264 / 1e-91 AT5G17260 97 / 5e-24 NAC domain containing protein 86 (.1) Potri.012G024100 [exp] 239 / 7e-82 AT5G17260 90 / 2e-21 NAC domain containing protein 86 (.1) Potri.004G119400 [exp] 233 / 3e-79 AT1G69490 88 / 2e-21 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.001G061200 [exp] 96 / 2e-24 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.010G166200 [exp] 96 / 4e-24 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.009G052300 [exp] 96 / 1e-23 AT1G01720 179 / 2e-53 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G166500 [exp] 94 / 1e-23 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.008G089000 [exp] 94 / 2e-23 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001809 [exp] 99 / 2e-25 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10002581 [exp] 94 / 7e-24 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10003847 [exp] 93 / 6e-23 AT1G61110 196 / 3e-60 NAC domain containing protein 25 (.1) Lus10037156 [exp] 91 / 3e-22 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10026373 [exp] 90 / 1e-21 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10042284 [exp] 89 / 1e-21 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10036773 [exp] 89 / 3e-21 AT1G69490 318 / 1e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10032238 [exp] 87 / 2e-20 AT1G12260 432 / 6e-151 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10031721 [exp] 86 / 4e-20 AT1G12260 353 / 4e-121 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10031142 [exp] 86 / 5e-20 AT1G12260 351 / 4e-120 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.015G007000.2 pacid=42775536 polypeptide=Potri.015G007000.2.p locus=Potri.015G007000 ID=Potri.015G007000.2.v4.1 annot-version=v4.1 ATGGCCAGTGGTGCACAAGCTACGAATGTGCCTACCGGCTACAGATTTAGCCCTAATGATGATGATCTAATAGTTCATTATTTGAAGAAAAAAATTCTGG GTCAGCAACTTCCTGCTGATGTTATTCCCACCACTGATGTATATGCATCAAGCCCTGATAAACTCCCCTTAGACGATTTTAAAGGCGGGGTGGCCAACGA GTGGTTTTTCTTTTCGACTAGGAGCGAGGACGCTGACATTATCTTAACAGAGAATGGCTACTATGCGGTTGACCCCGAAGGCACAGCCCCGATCGCATGG AAGGATAAAATTGTTGGTTATGCAAAGACTCTGAATTTCTATCAAGGAAGCCCACCCAATGGATCTGAAACTGATTGGATGGTAGAAGAATTCAGCGTTA ATGCTGAGTTTGTTCCAATTAACAAAGATGACCATAGCACTCAAGAAAAGAAAGCCAACTTTGTTGTATGCAAAATTTATCGAGTAGAAACAGAACCTGA ATGGGACAAGCAGTTCAAGTAA
AA sequence Show only first row Show all	>Potri.015G007000.2 pacid=42775536 polypeptide=Potri.015G007000.2.p locus=Potri.015G007000 ID=Potri.015G007000.2.v4.1 annot-version=v4.1 MASGAQATNVPTGYRFSPNDDDLIVHYLKKKILGQQLPADVIPTTDVYASSPDKLPLDDFKGGVANEWFFFSTRSEDADIILTENGYYAVDPEGTAPIAW KDKIVGYAKTLNFYQGSPPNGSETDWMVEEFSVNAEFVPINKDDHSTQEKKANFVVCKIYRVETEPEWDKQFK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G33480	NAC	ANAC041	NAC domain containing protein ...		Potri.015G007000 [exp]	0	1
					Potri.001G020250 [exp]	7.21	0.8858
AT1G76820			eukaryotic translation initiat...		Potri.011G132100 [exp]	9.38	0.7288
					Potri.012G119350 [exp]	10.19	0.8858
					Potri.018G049733 [exp]	12.80	0.7344
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Potri.001G144933 [exp]	13.49	0.8844
					Potri.002G111832 [exp]	16.15	0.8767
AT4G25040			Uncharacterised protein family...		Potri.015G103600 [exp]	18.38	0.8040
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.008G099201 [exp]	19.07	0.8371
					Potri.002G047750 [exp]	20.17	0.8448
AT5G12260			unknown protein		Potri.012G123450 [exp]	22.58	0.8330

Compare expression of checked genes

Potri.015G007000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.