Potri.015G014150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.015G014150.1 pacid=42776443 polypeptide=Potri.015G014150.1.p locus=Potri.015G014150 ID=Potri.015G014150.1.v4.1 annot-version=v4.1
ATGATTAATCACAGGAGAGGCGTGTTGACGGACAGAATACCATCAGTCGCAAACATTGATCAAACACTGATGTCACACTTTGGTGCAGAAACAGATGGGC
AAACTTCAACGAGGAAACGAGGGCAAAATTTCATGGAGCAGCGAGGGCCTGGCTCCAGTGATCAGCTGACAAGGGAAAAAGCTGATCTGTACCACGACCT
TCCTTCCTCAGAGTCTTGGGAAGAAGAAGAATAA
AA sequence
>Potri.015G014150.1 pacid=42776443 polypeptide=Potri.015G014150.1.p locus=Potri.015G014150 ID=Potri.015G014150.1.v4.1 annot-version=v4.1
MINHRRGVLTDRIPSVANIDQTLMSHFGAETDGQTSTRKRGQNFMEQRGPGSSDQLTREKADLYHDLPSSESWEEEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.015G014150 0 1
Potri.015G021450 3.46 0.9157
AT1G02790 PGA4 polygalacturonase 4 (.1) Potri.010G011100 5.29 0.8721
AT1G01280 CYP703A2 "cytochrome P450, family 703, ... Potri.014G099600 6.00 0.7395
AT1G64160 Disease resistance-responsive ... Potri.001G096440 14.07 0.5836
AT1G60500 DRP4C Dynamin related protein 4C (.1... Potri.001G095900 14.96 0.6486
AT1G43760 DNAse I-like superfamily prote... Potri.004G128901 16.00 0.5106
AT4G38040 Exostosin family protein (.1) Potri.012G024150 26.11 0.5112
Potri.004G073950 42.42 0.4454
Potri.017G069350 54.77 0.4786
Potri.007G018201 59.32 0.4102

Potri.015G014150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.