Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13260 43 / 1e-05 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) AT2G46870 41 / 6e-05 B3 NGA1 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) AT1G16640 37 / 0.0009 B3 AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G015501 [exp] 228 / 9e-79 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015275 [exp] 227 / 2e-78 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 220 / 5e-76 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015800 [exp] 163 / 4e-53 AT1G13260 44 / 7e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.012G012950 [exp] 162 / 8e-53 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.015G016901 [exp] 160 / 5e-52 AT1G34390 49 / 1e-07 auxin response factor 22 (.1) Potri.012G013000 [exp] 160 / 6e-52 AT4G01500 46 / 9e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013700 [exp] 159 / 7e-52 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012850 [exp] 157 / 8e-51 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.015G014850.1 pacid=42774990 polypeptide=Potri.015G014850.1.p locus=Potri.015G014850 ID=Potri.015G014850.1.v4.1 annot-version=v4.1 ATGGCGAGATTCTCAAAGGTGCTTAGGAAGACTGATATTAAGAAGAGACTCTCAGTGCCGACCGGGTTTCTCAGCTCTCTTCCATCTTTTAATGCTGGTG GTCATGCTGTAGATTTTCAAGCTGTAGATGGAAGTGGCCGTGTTTGGACCTTCAGATGCTCAATTCGCAGGAATGGACATCCAAAACCAGTTTTTTCAAA GGGTTGGCTCGCTTATGTTCATAGCAAGAGCCTTAAAGTTGGTGACAAGGTCCAGTTTTTAAAGGAGAAAAACGACGCTGGCGCCAAAATGCATGCTTAC GAGATTCGGGCTGAGAAAGAAATCAAGATATTTGGTGCTGTTTTCGGATATGCACCCATAATATAG
AA sequence Show only first row Show all	>Potri.015G014850.1 pacid=42774990 polypeptide=Potri.015G014850.1.p locus=Potri.015G014850 ID=Potri.015G014850.1.v4.1 annot-version=v4.1 MARFSKVLRKTDIKKRLSVPTGFLSSLPSFNAGGHAVDFQAVDGSGRVWTFRCSIRRNGHPKPVFSKGWLAYVHSKSLKVGDKVQFLKEKNDAGAKMHAY EIRAEKEIKIFGAVFGYAPII

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.015G014850 [exp]	0	1
AT4G10270			Wound-responsive family protei...		Potri.019G116600 [exp]	2.82	0.8352
AT4G36240	GATA	GATA7	GATA transcription factor 7 (....		Potri.005G066100 [exp]	3.16	0.8394
AT5G66985			unknown protein		Potri.002G130500 [exp]	6.32	0.8037
AT2G39100			RING/U-box superfamily protein...		Potri.008G215200 [exp]	6.70	0.8282
					Potri.019G089100 [exp]	8.83	0.7642
					Potri.001G042800 [exp]	11.48	0.7768
AT4G10270			Wound-responsive family protei...		Potri.019G116800 [exp]	16.52	0.7854
					Potri.018G114801 [exp]	25.13	0.7835
AT5G08305			Pentatricopeptide repeat (PPR)...		Potri.007G073100 [exp]	25.76	0.8123
AT3G16640		TCTP	translationally controlled tum...		Potri.010G013400 [exp]	34.92	0.7504	Pt-TCTP.2

Compare expression of checked genes

Potri.015G014850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.