Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13260 44 / 5e-06 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) AT4G01500 44 / 7e-06 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G68840 44 / 1e-05 AP2_ERF EDF2, RAV2, RAP2.8, TEM2, AtRAV2 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) AT1G25560 42 / 3e-05 AP2_ERF EDF1, TEM1 TEMPRANILLO 1, ETHYLENE RESPONSE DNA BINDING FACTOR 1, AP2/B3 transcription factor family protein (.1) AT1G01030 39 / 0.0004 B3 NGA3 NGATHA3, AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G015275 [exp] 166 / 2e-54 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G014850 [exp] 163 / 4e-53 AT4G01500 45 / 3e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 161 / 2e-52 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015501 [exp] 160 / 3e-52 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.012G013700 [exp] 160 / 4e-52 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013501 [exp] 159 / 9e-52 AT4G01500 48 / 3e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 156 / 2e-50 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G012850 [exp] 154 / 2e-49 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G016901 [exp] 152 / 1e-48 AT1G34390 49 / 1e-07 auxin response factor 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034276 [exp] 40 / 0.0002 AT1G68840 233 / 4e-76 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Lus10035059 [exp] 40 / 0.0002 AT1G13260 250 / 2e-96 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10021707 [exp] 40 / 0.0002 AT1G13260 369 / 1e-127 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10026510 [exp] 39 / 0.0008 AT4G30080 694 / 0.0 auxin response factor 16 (.1) Lus10019940 [exp] 39 / 0.0008 AT4G30080 660 / 0.0 auxin response factor 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.015G015800.1 pacid=42775002 polypeptide=Potri.015G015800.1.p locus=Potri.015G015800 ID=Potri.015G015800.1.v4.1 annot-version=v4.1 ATGGCAAAGTTCTCAAAGAAACTTAGCAAGACAGATGTCCGAAAGAGACTCGCAGTGCCAACCAGGTCTCTCAGCTCTCTTCCATCCTTTGATGGTGCTC ATGCTGTATATTTTCAAGCTGCAGATGAAAGAGGTGAGGTTTGGACCTTCAAATGCTCCATTCGCAAACGAAGGCACCCAAAACCAGTTCTTTCAAAGGA TTGGCTCGCATTTGTTGACAGCAAGGGCCTTAAAGCTGGTGACATGATCGAGTTCTACAAGGAGACAAACGAAGCCGCCACAGCACATGCTTACAAGGTT CGGGCTGAAAGACAAATCAAGATATTTGGTGTTGTTTTTGGGTATGCTCCTATTACAGCAATATCCCATGACTCCAGCGATGTTTCTCCAATATAA
AA sequence Show only first row Show all	>Potri.015G015800.1 pacid=42775002 polypeptide=Potri.015G015800.1.p locus=Potri.015G015800 ID=Potri.015G015800.1.v4.1 annot-version=v4.1 MAKFSKKLSKTDVRKRLAVPTRSLSSLPSFDGAHAVYFQAADERGEVWTFKCSIRKRRHPKPVLSKDWLAFVDSKGLKAGDMIEFYKETNEAATAHAYKV RAERQIKIFGVVFGYAPITAISHDSSDVSPI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Potri.015G015800 [exp]	0	1
					Potri.012G053301 [exp]	4.12	0.9745
AT2G25625			unknown protein		Potri.006G248300 [exp]	4.89	0.9801
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Potri.004G192900 [exp]	8.24	0.9830
AT1G68380			Core-2/I-branching beta-1,6-N-...		Potri.008G123500 [exp]	10.24	0.9755
AT3G20180			Copper transport protein famil...		Potri.001G378700 [exp]	10.29	0.9847
					Potri.015G034182 [exp]	11.61	0.9780
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.010G109100 [exp]	11.66	0.9620
AT4G20800			FAD-binding Berberine family p...		Potri.011G155900 [exp]	12.40	0.9597
AT1G16260			Wall-associated kinase family ...		Potri.003G185700 [exp]	16.94	0.9799
AT2G21100			Disease resistance-responsive ...		Potri.001G214600 [exp]	21.00	0.9829

Compare expression of checked genes

Potri.015G015800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.