Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01500 54 / 2e-09 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G34390 54 / 3e-09 ARF ARF22 auxin response factor 22 (.1) AT1G43950 52 / 6e-09 ARF ARF23 auxin response factor 23 (.1) AT1G35520 52 / 6e-09 ARF ARF15 auxin response factor 15 (.1) AT1G35240 49 / 9e-08 ARF ARF20 auxin response factor 20 (.1) AT1G35540 49 / 1e-07 ARF ARF14 auxin response factor 14 (.1) AT1G01030 49 / 1e-07 B3 NGA3 NGATHA3, AP2/B3-like transcriptional factor family protein (.1) AT2G33860 48 / 3e-07 ARF ARF3, ETT ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1) AT1G34310 47 / 5e-07 ARF ARF12 auxin response factor 12 (.1) AT4G30080 47 / 6e-07 ARF ARF16 auxin response factor 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G016000 [exp] 206 / 3e-70 AT4G01500 47 / 6e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G016450 [exp] 147 / 5e-47 AT4G01500 47 / 4e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013700 [exp] 147 / 5e-47 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012850 [exp] 147 / 6e-47 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 147 / 7e-47 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G013167 [exp] 143 / 2e-45 AT1G43950 49 / 1e-07 auxin response factor 23 (.1) Potri.015G016901 [exp] 140 / 4e-44 AT1G34390 49 / 1e-07 auxin response factor 22 (.1) Potri.012G013000 [exp] 138 / 2e-43 AT4G01500 46 / 9e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G017000 [exp] 137 / 4e-43 AT1G34390 52 / 1e-08 auxin response factor 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 55 / 1e-09 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10005264 [exp] 50 / 4e-08 AT2G33860 580 / 0.0 ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1) Lus10013942 [exp] 50 / 7e-08 AT2G33860 579 / 0.0 ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1) Lus10021467 [exp] 49 / 1e-07 AT4G30080 588 / 0.0 auxin response factor 16 (.1) Lus10005930 [exp] 47 / 5e-07 AT5G62000 361 / 2e-112 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10026510 [exp] 47 / 6e-07 AT4G30080 694 / 0.0 auxin response factor 16 (.1) Lus10040906 [exp] 47 / 8e-07 AT5G62000 367 / 2e-114 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10019940 [exp] 46 / 1e-06 AT4G30080 660 / 0.0 auxin response factor 16 (.1) Lus10016091 [exp] 46 / 1e-06 AT4G30080 315 / 7e-103 auxin response factor 16 (.1) Lus10023519 [exp] 45 / 2e-06 AT4G30080 622 / 0.0 auxin response factor 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.015G016100.1 pacid=42776684 polypeptide=Potri.015G016100.1.p locus=Potri.015G016100 ID=Potri.015G016100.1.v4.1 annot-version=v4.1 ATGGCCATCTTCTCCAAGATCCTCACCAAGACAGATGCTGAGAAGAGACTGTCAGTGCCTATCAAGTTTCTCAAGTCTCTCCCGCCATTCAAAAGCGGCC ATGCGGTAGATTTTCAAGCTAAAGATGAGAGGGGAAAGGTCTGGACTTTTCAATGCTCCACTCGCAAGAAAGGACGGTACAAGAAGCCAGTTCTTTCCAA GGGTTGGCTTGCATTTGCAAACAAGAAGAAACTTAAAGTGGGTGACAAGATCGTGTTTTACAAGGGTAGACATCAAGAAACTGAAAAACCCTTTTATGGA GTTCGAGTTGAAAGAGAAATCAAGATACTCGGTGCTGTTATTGGCTATATGAACCCTTAA
AA sequence Show only first row Show all	>Potri.015G016100.1 pacid=42776684 polypeptide=Potri.015G016100.1.p locus=Potri.015G016100 ID=Potri.015G016100.1.v4.1 annot-version=v4.1 MAIFSKILTKTDAEKRLSVPIKFLKSLPPFKSGHAVDFQAKDERGKVWTFQCSTRKKGRYKKPVLSKGWLAFANKKKLKVGDKIVFYKGRHQETEKPFYG VRVEREIKILGAVIGYMNP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.015G016100 [exp]	0	1
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184900 [exp]	10.09	0.7630
AT5G42720			Glycosyl hydrolase family 17 p...		Potri.014G183000 [exp]	15.42	0.7478
AT1G11880			transferases, transferring hex...		Potri.001G008600 [exp]	17.66	0.6686
AT5G18910			Protein kinase superfamily pro...		Potri.010G027301 [exp]	18.41	0.7455
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182800 [exp]	21.26	0.7311
AT3G51000			alpha/beta-Hydrolases superfam...		Potri.011G048000 [exp]	30.00	0.6740
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Potri.003G146600 [exp]	36.16	0.7248
AT4G38190		ATCSLD4	ARABIDOPSIS THALIANA CELLULOSE...		Potri.009G170000 [exp]	37.50	0.7198	ATCSLD4.1
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184100 [exp]	39.82	0.7073
AT1G13680			PLC-like phosphodiesterases su...		Potri.004G117500 [exp]	46.73	0.7197

Compare expression of checked genes

Potri.015G016100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.