Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53450 180 / 3e-55 ORG1 OBP3-responsive gene 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G017100 [exp] 199 / 7e-62 AT5G53450 890 / 0.0 OBP3-responsive gene 1 (.1.2) Potri.015G016801 [exp] 197 / 7e-62 AT5G53450 758 / 0.0 OBP3-responsive gene 1 (.1.2) Potri.015G016500 [exp] 63 / 6e-13 AT5G53450 288 / 2e-93 OBP3-responsive gene 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038813 [exp] 183 / 1e-55 AT5G53450 817 / 0.0 OBP3-responsive gene 1 (.1.2) Lus10014920 [exp] 174 / 3e-52 AT5G53450 567 / 0.0 OBP3-responsive gene 1 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.015G016300.3 pacid=42776339 polypeptide=Potri.015G016300.3.p locus=Potri.015G016300 ID=Potri.015G016300.3.v4.1 annot-version=v4.1 ATGATTGCATTTGACATGAGATGTGTAGGATCTATGATGGCAAAAATGGTGCTGCGGGAACTCATGGATCCATTAATTTTCATGAAGTTCAAATCATTCC TCATGAAGATACTTGATCGGAACTGGGGTGCTGGTTGGAACCTTTTATCCTTGTTATTGGCAACCAAACCTTCAAAAAGAATAAGTTGTTTGGATGCCCT CAGGCATCCATTTCTGTGTGGACCAAGATGGCCGGTGGCGCCATCCATGGATATCATCAGATGGGTTCTTAACTCAACTGCAGTTCGAATTACAGAGGAA TACATTTATAAGCAGCCCCAGTTTCATGTTCTGAGCATAGAGTAG
AA sequence Show only first row Show all	>Potri.015G016300.3 pacid=42776339 polypeptide=Potri.015G016300.3.p locus=Potri.015G016300 ID=Potri.015G016300.3.v4.1 annot-version=v4.1 MIAFDMRCVGSMMAKMVLRELMDPLIFMKFKSFLMKILDRNWGAGWNLLSLLLATKPSKRISCLDALRHPFLCGPRWPVAPSMDIIRWVLNSTAVRITEE YIYKQPQFHVLSIE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Potri.015G016300 [exp]	0	1
AT4G30100			P-loop containing nucleoside t...		Potri.002G093500 [exp]	3.46	0.8368
AT1G66340		AtETR1, EIN1, E...	ETHYLENE RESPONSE 1, ETHYLENE ...		Potri.003G032300 [exp]	17.60	0.7232	ETR1.2
AT4G18270		ATTRANS11	ARABIDOPSIS THALIANA TRANSLOCA...		Potri.011G080600 [exp]	21.16	0.7241
AT3G24600			Late embryogenesis abundant pr...		Potri.006G160100 [exp]	22.04	0.7013
AT5G62200			Embryo-specific protein 3, (AT...		Potri.012G130800 [exp]	23.15	0.6554
					Potri.001G284801 [exp]	26.68	0.7743
AT5G01270		CPL2, ATCPL2	carboxyl-terminal domain (ctd)...		Potri.006G099302 [exp]	26.83	0.7505
AT1G64320			myosin heavy chain-related (.1...		Potri.001G094332 [exp]	29.93	0.7498
AT4G38200			SEC7-like guanine nucleotide e...		Potri.009G169800 [exp]	32.03	0.7484
AT4G34100			RING/U-box superfamily protein...		Potri.009G099400 [exp]	35.70	0.7044

Compare expression of checked genes

Potri.015G016300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.