Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G34390 47 / 4e-07 ARF ARF22 auxin response factor 22 (.1) AT4G01500 47 / 4e-07 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G16640 46 / 5e-07 B3 AP2/B3-like transcriptional factor family protein (.1) AT1G43950 44 / 3e-06 ARF ARF23 auxin response factor 23 (.1) AT5G06250 44 / 6e-06 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT3G11580 43 / 1e-05 B3 AP2/B3-like transcriptional factor family protein (.1.2) AT4G23980 43 / 1e-05 ARF ARF9 auxin response factor 9 (.1.2) AT1G77850 43 / 2e-05 ARF ARF17 auxin response factor 17 (.1) AT1G35520 42 / 2e-05 ARF ARF15 auxin response factor 15 (.1) AT2G36080 42 / 2e-05 B3 ABS2, NGAL1 AP2/B3-like transcriptional factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G016901 [exp] 212 / 1e-72 AT1G34390 49 / 1e-07 auxin response factor 22 (.1) Potri.015G016700 [exp] 205 / 4e-70 AT1G34390 46 / 1e-06 auxin response factor 22 (.1) Potri.015G017000 [exp] 202 / 6e-69 AT1G34390 52 / 1e-08 auxin response factor 22 (.1) Potri.012G012950 [exp] 166 / 1e-54 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G012850 [exp] 161 / 1e-52 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 151 / 1e-48 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G014850 [exp] 151 / 2e-48 AT4G01500 45 / 3e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015275 [exp] 150 / 4e-48 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013700 [exp] 150 / 5e-48 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021326 [exp] 45 / 4e-06 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10030240 [exp] 44 / 6e-06 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10004226 [exp] 43 / 2e-05 AT5G06250 183 / 4e-55 AP2/B3-like transcriptional factor family protein (.1.2) Lus10026510 [exp] 43 / 2e-05 AT4G30080 694 / 0.0 auxin response factor 16 (.1) Lus10007440 [exp] 42 / 2e-05 AT1G59750 917 / 0.0 auxin response factor 1 (.1.2.3.4) Lus10019940 [exp] 42 / 3e-05 AT4G30080 660 / 0.0 auxin response factor 16 (.1) Lus10023058 [exp] 41 / 6e-05 AT4G23980 743 / 0.0 auxin response factor 9 (.1.2) Lus10024753 [exp] 41 / 9e-05 AT1G77850 494 / 2e-169 auxin response factor 17 (.1) Lus10024455 [exp] 41 / 0.0001 AT1G59750 905 / 0.0 auxin response factor 1 (.1.2.3.4) Lus10009770 [exp] 40 / 0.0001 AT1G77850 496 / 4e-170 auxin response factor 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.015G016450.1 pacid=42776629 polypeptide=Potri.015G016450.1.p locus=Potri.015G016450 ID=Potri.015G016450.1.v4.1 annot-version=v4.1 ATGGAAAACTTCTGGAAGATCCTCAGAAAGACTGATGCTAAGAAGAGGCTGTCAGTTCCTATCAGCTTTCTCAGGTCTCTTCCACCTTTCAAACTAGGCA GCCATGCCGTCACGTTTGAAGCTACAGACGAGAAAGGCGAAGCTTGGGCCTTTCAATGCTCCATCCGCAAGAGAGGACAGTACCCGAAGCCAGTCCTCAC AAGAGGTTGGGTTGCATTCGTTAAGAGCAAGAAGCTACAAGTTGGTGACAAGGTCAGGTTTATGAAACATAAGAACCGAGCTACTGCAGCAATCTCTTAC AAAGTTCGTGTTGAAAAGGAAATCAAGGTCTTTGGTGCTATATTTGGCTATGCACGGATCTAA
AA sequence Show only first row Show all	>Potri.015G016450.1 pacid=42776629 polypeptide=Potri.015G016450.1.p locus=Potri.015G016450 ID=Potri.015G016450.1.v4.1 annot-version=v4.1 MENFWKILRKTDAKKRLSVPISFLRSLPPFKLGSHAVTFEATDEKGEAWAFQCSIRKRGQYPKPVLTRGWVAFVKSKKLQVGDKVRFMKHKNRATAAISY KVRVEKEIKVFGAIFGYARI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.015G016450 [exp]	0	1
AT3G29400		ATEXO70E1	exocyst subunit exo70 family p...		Potri.017G093650 [exp]	3.87	0.8433
					Potri.002G003050 [exp]	5.19	0.8525
					Potri.001G027950 [exp]	5.47	0.8354
AT3G25400			unknown protein		Potri.002G235000 [exp]	5.47	0.8683
					Potri.010G007899 [exp]	10.39	0.8276
					Potri.015G098650 [exp]	10.95	0.8529
AT3G24255			RNA-directed DNA polymerase (r...		Potri.004G185050 [exp]	14.83	0.8456
					Potri.013G049550 [exp]	17.66	0.7885
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Potri.014G179400 [exp]	19.33	0.8117
AT2G29060	GRAS		GRAS family transcription fact...		Potri.001G242100 [exp]	20.07	0.8064

Compare expression of checked genes

Potri.015G016450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.