Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G34390 52 / 1e-08 ARF ARF22 auxin response factor 22 (.1) AT4G01500 49 / 1e-07 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G43950 46 / 1e-06 ARF ARF23 auxin response factor 23 (.1) AT4G21550 46 / 1e-06 B3 HSI2-L2, VAL3 VP1/ABI3-like 3 (.1) AT1G16640 44 / 2e-06 B3 AP2/B3-like transcriptional factor family protein (.1) AT1G35540 45 / 4e-06 ARF ARF14 auxin response factor 14 (.1) AT1G35520 44 / 6e-06 ARF ARF15 auxin response factor 15 (.1) AT1G35240 43 / 1e-05 ARF ARF20 auxin response factor 20 (.1) AT1G13260 42 / 4e-05 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) AT1G77850 42 / 5e-05 ARF ARF17 auxin response factor 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G016901 [exp] 222 / 2e-76 AT1G34390 49 / 1e-07 auxin response factor 22 (.1) Potri.015G016700 [exp] 215 / 9e-74 AT1G34390 46 / 1e-06 auxin response factor 22 (.1) Potri.015G016450 [exp] 202 / 7e-69 AT4G01500 47 / 4e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 169 / 2e-55 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G012850 [exp] 167 / 7e-55 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G014850 [exp] 156 / 2e-50 AT4G01500 45 / 3e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015275 [exp] 155 / 4e-50 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 155 / 6e-50 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015501 [exp] 155 / 6e-50 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 47 / 8e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10021326 [exp] 44 / 1e-05 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10005930 [exp] 43 / 2e-05 AT5G62000 361 / 2e-112 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10026510 [exp] 43 / 3e-05 AT4G30080 694 / 0.0 auxin response factor 16 (.1) Lus10019940 [exp] 42 / 3e-05 AT4G30080 660 / 0.0 auxin response factor 16 (.1) Lus10040906 [exp] 42 / 3e-05 AT5G62000 367 / 2e-114 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10007440 [exp] 41 / 7e-05 AT1G59750 917 / 0.0 auxin response factor 1 (.1.2.3.4) Lus10024754 [exp] 41 / 8e-05 AT1G77850 505 / 1e-173 auxin response factor 17 (.1) Lus10004226 [exp] 41 / 8e-05 AT5G06250 183 / 4e-55 AP2/B3-like transcriptional factor family protein (.1.2) Lus10005264 [exp] 41 / 9e-05 AT2G33860 580 / 0.0 ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.015G017000.1 pacid=42775178 polypeptide=Potri.015G017000.1.p locus=Potri.015G017000 ID=Potri.015G017000.1.v4.1 annot-version=v4.1 ATGGCAGCGTTCTCCAAGATCCTCAGAGAGACTGATACTAAGAAGAGGCTGTCAGTTCCTATCAGGTTTCTCAGGTCTCTTCCACCTTTCAAACTAGGCA GCCATGCCGTCACGTTTGAAGCTACAGACGAGAAAGGCGAAGCTTGGCCCTTTCAATGCTCCATCCGCAAGAGAGGACACCCGAAGCCAGTCCTCACAAA AGGTTGGGTTGCGTTCGTTAAGAGCAAGAAGCTACAAGTTGGTGACAAGGTCAGGTTTATTAAACGTAAGAACCGAGCTACTGCAGCAATCTCTTACATA GTTCGTGCTGAAAAGGCAATCAAGATCTTTGGTGTTACATTTGGCTATGCCCGGATTGATCTAGTCCATTTCCCTAATTAA
AA sequence Show only first row Show all	>Potri.015G017000.1 pacid=42775178 polypeptide=Potri.015G017000.1.p locus=Potri.015G017000 ID=Potri.015G017000.1.v4.1 annot-version=v4.1 MAAFSKILRETDTKKRLSVPIRFLRSLPPFKLGSHAVTFEATDEKGEAWPFQCSIRKRGHPKPVLTKGWVAFVKSKKLQVGDKVRFIKRKNRATAAISYI VRAEKAIKIFGVTFGYARIDLVHFPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G34390	ARF	ARF22	auxin response factor 22 (.1)		Potri.015G017000 [exp]	0	1
					Potri.002G047750 [exp]	12.32	0.6594
					Potri.003G046750 [exp]	15.03	0.6423
AT5G12260			unknown protein		Potri.012G123450 [exp]	24.89	0.6372
AT2G34790		MEE23, EDA28	MATERNAL EFFECT EMBRYO ARREST ...		Potri.011G166601 [exp]	26.55	0.6330
					Potri.002G111832 [exp]	36.46	0.6262
AT1G08500		AtENODL18	early nodulin-like protein 18 ...		Potri.014G072700 [exp]	36.74	0.5851
					Potri.001G020250 [exp]	38.57	0.6250
					Potri.012G119350 [exp]	49.17	0.6250
AT1G34390	ARF	ARF22	auxin response factor 22 (.1)		Potri.015G016700 [exp]	51.84	0.4586
AT2G32440		ATKAO2, CYP88A4...	ARABIDOPSIS ENT-KAURENOIC ACID...		Potri.001G144933 [exp]	54.35	0.6146

Compare expression of checked genes

Potri.015G017000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.