Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53460 86 / 2e-21 GLT1 NADH-dependent glutamate synthase 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G017500 [exp] 141 / 7e-41 AT5G53460 3665 / 0.0 NADH-dependent glutamate synthase 1 (.1.2.3) Potri.012G011700 [exp] 131 / 2e-37 AT5G53460 3649 / 0.0 NADH-dependent glutamate synthase 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019020 [exp] 96 / 9e-25 AT5G53460 1280 / 0.0 NADH-dependent glutamate synthase 1 (.1.2.3) Lus10000390 [exp] 93 / 7e-24 AT5G53460 3795 / 0.0 NADH-dependent glutamate synthase 1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.015G017601.1 pacid=42774921 polypeptide=Potri.015G017601.1.p locus=Potri.015G017601 ID=Potri.015G017601.1.v4.1 annot-version=v4.1 ATGGTAGCATCCTCTTCTTTCATGAGATATTTGTCCACCTGGGAAGCAGCTTGTCGTCCCTCTGATATTGCCCATACAACTAGGGACTGGCCTCGCCTGC AATCCCCAGCTGCAAAGATCCCTTCCACATTGGTTGAGAAGCGGCCATATTCTGCCTTGAAATTCGATCTATTATCTTGCTCCAAGCCCAACTTCTCTGC CACATTCTGTTAA
AA sequence Show only first row Show all	>Potri.015G017601.1 pacid=42774921 polypeptide=Potri.015G017601.1.p locus=Potri.015G017601 ID=Potri.015G017601.1.v4.1 annot-version=v4.1 MVASSSFMRYLSTWEAACRPSDIAHTTRDWPRLQSPAAKIPSTLVEKRPYSALKFDLLSCSKPNFSATFC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53460		GLT1	NADH-dependent glutamate synth...		Potri.015G017601 [exp]	0	1
AT2G23090			Uncharacterised protein family...		Potri.014G018400 [exp]	25.03	0.7874
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.003G066300 [exp]	38.14	0.7632
AT1G24520		BCP1	homolog of Brassica campestris...		Potri.012G095900 [exp]	40.09	0.6915
AT5G51150			Mitochondrial import inner mem...		Potri.012G113700 [exp]	43.12	0.7405
AT1G31720			Protein of unknown function (D...		Potri.004G235000 [exp]	60.09	0.7431
AT4G31860			Protein phosphatase 2C family ...		Potri.018G017800 [exp]	90.55	0.7330
AT1G49800			unknown protein		Potri.009G095600 [exp]	92.37	0.7248
AT4G27880			Protein with RING/U-box and TR...		Potri.015G013000 [exp]	124.71	0.7184
					Potri.010G219350 [exp]	176.29	0.6778
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.008G034401 [exp]	216.43	0.6889

Compare expression of checked genes

Potri.015G017601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.