Plant FIBer expression Database

Potri.015G020100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00080 64 / 3e-16 ATCG00080.1, PSBI photosystem II reaction center protein I (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G138690
[exp]
64 / 3e-16 ATCG00080 73 / 5e-20 photosystem II reaction center protein I (.1)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02532 PsbI Photosystem II reaction centre I protein (PSII 4.8 kDa protein)
Representative CDS sequence
>Potri.015G020100.1 pacid=42775001 polypeptide=Potri.015G020100.1.p locus=Potri.015G020100 ID=Potri.015G020100.1.v4.1 annot-version=v4.1
ATGCTTACTCTCAAACTCTTTGTTTACACAGTAGTAATATTATTTGCTTCCATTTTCATCTTTGGGTTTTTATCTAATGATCCAGGGTGTAATCCTAGAC
GTGAAGAATAA
AA sequence
>Potri.015G020100.1 pacid=42775001 polypeptide=Potri.015G020100.1.p locus=Potri.015G020100 ID=Potri.015G020100.1.v4.1 annot-version=v4.1
MLTLKLFVYTVVILFASIFIFGFLSNDPGCNPRREE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00080 ATCG00080.1, PS... photosystem II reaction center... Potri.015G020100
[exp]
0 1
Potri.007G062162
[exp]
19.23 0.7510
ATCG01250 ATCG01250.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.008G207100
[exp]
23.30 0.7462
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Potri.019G028400
[exp]
32.55 0.7289
ATMG00640 ATMG00640.1, OR... hydrogen ion transporting ATP ... Potri.007G062422
[exp]
36.37 0.7136
AT3G56960 PIP5K4 phosphatidyl inositol monophos... Potri.016G036800
[exp]
44.32 0.5960
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Potri.005G154512
[exp]
52.44 0.7060
AT4G35720 Arabidopsis protein of unknown... Potri.005G103800
[exp]
55.99 0.6178
ATMG01010 ATMG01010.1, OR... Unknown conserved protein (.1) Potri.007G062262
[exp]
58.68 0.7001
ATMG00410 ATMG00410.1, AT... ATPase subunit 6-1 (.1) Potri.014G168000
[exp]
58.99 0.6954
Potri.004G014401
[exp]
61.13 0.6860

Potri.015G020100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.