Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53250 71 / 3e-18 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT3G61640 69 / 1e-17 AGP20, ATAGP20 arabinogalactan protein 20 (.1) AT2G46330 67 / 8e-17 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2) AT5G24105 59 / 9e-14 AGP41 arabinogalactan protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G032000 [exp] 95 / 9e-28 AT3G61640 66 / 3e-16 arabinogalactan protein 20 (.1) Potri.014G094800 [exp] 58 / 6e-13 AT3G61640 42 / 1e-06 arabinogalactan protein 20 (.1) Potri.018G078801 [exp] 51 / 1e-10 ND / Potri.001G094700 [exp] 49 / 1e-09 AT2G46330 57 / 7e-13 arabinogalactan protein 16 (.1.2) Potri.003G136600 [exp] 46 / 1e-08 AT5G53250 55 / 7e-12 arabinogalactan protein 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032355 [exp] 55 / 3e-11 AT3G61640 60 / 9e-13 arabinogalactan protein 20 (.1) Lus10033939 [exp] 55 / 6e-11 AT3G61640 61 / 4e-13 arabinogalactan protein 20 (.1) Lus10037436 [exp] 49 / 1e-09 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1) Lus10000542 [exp] 49 / 2e-09 AT2G46330 63 / 6e-15 arabinogalactan protein 16 (.1.2) Lus10024263 [exp] 43 / 3e-07 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10023629 [exp] 43 / 3e-07 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10041273 [exp] 37 / 0.0001 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [poplar] [flax] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Potri.015G022600.1 pacid=42774783 polypeptide=Potri.015G022600.1.p locus=Potri.015G022600 ID=Potri.015G022600.1.v4.1 annot-version=v4.1 ATGGCTGTTTCTAACATTTCATTTGGAGTTTTAGCTGCCATTGTTGTCATGATCTGTGCCATCTTTATGCCTTTGGCTCATGGCCAATCCTCAGCTCCTG CTCCATCACCCACAAGCGATGGCACTGCAATAGATCAAGGAATAGCTTGTATTCTGATGCTTGCGGCATTGGTGCTCACATACCTTATTCACTGA
AA sequence Show only first row Show all	>Potri.015G022600.1 pacid=42774783 polypeptide=Potri.015G022600.1.p locus=Potri.015G022600 ID=Potri.015G022600.1.v4.1 annot-version=v4.1 MAVSNISFGVLAAIVVMICAIFMPLAHGQSSAPAPSPTSDGTAIDQGIACILMLAALVLTYLIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53250		AGP22, ATAGP22	arabinogalactan protein 22 (.1...		Potri.015G022600 [exp]	0	1
AT4G27300			S-locus lectin protein kinase ...		Potri.010G018050 [exp]	6.63	0.6921
AT4G27290			S-locus lectin protein kinase ...		Potri.010G017800 [exp]	10.53	0.6380
AT4G34880			Amidase family protein (.1)		Potri.004G169400 [exp]	11.48	0.6328
					Potri.007G009000 [exp]	16.97	0.6117
AT4G27290			S-locus lectin protein kinase ...		Potri.010G018600 [exp]	20.32	0.6172
AT4G27290			S-locus lectin protein kinase ...		Potri.010G017100 [exp]	23.62	0.6003
					Potri.017G127501 [exp]	23.64	0.5822
AT5G09620			Octicosapeptide/Phox/Bem1p fam...		Potri.002G108800 [exp]	24.53	0.5822
					Potri.003G194950 [exp]	25.39	0.5822
AT5G13620			unknown protein		Potri.008G045000 [exp]	33.22	0.5485

Compare expression of checked genes

Potri.015G022600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.